SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257062039|ref|YP_003139927.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257062039|ref|YP_003139927.1|
Domain Number 1 Region: 241-295
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000392
Family Cold shock DNA-binding domain-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257062039|ref|YP_003139927.1|
Sequence length 299
Comment hypothetical protein Cyan8802_4306 [Cyanothece sp. PCC 8802]
Sequence
MTQDQKLTRIGIFYDGNYFLHVSNYYNYNHERKARVSIPGLHEFIRHQVAKEEGVDVRLC
QIVDAHYFRGRLSAGEASRNQLYYDRVFDDILMSEGVITHYLPLRTWGGKMEEKGIDVWL
ALEAFELAFYKRFSVLVLIACDGDYVPLVRKLNTLGTRVMVLSWDFNYINEYGDERITRT
SQDLLEEVTYPVAMHEIIDNRINRNDALINNLFASPKSSNKEFAVPPKTFSSEKSEIISL
QPGGYGFIKYPPNNLFFHFTDLVDVDFNDLEKGMKVEFSRGTNDRGETVAKNVKPLLDT
Download sequence
Identical sequences B7K6B5
395962.Cyan8802_4306 41431.PCC8801_4244 WP_015785222.1.62203 WP_015785222.1.93053 gi|218248953|ref|YP_002374324.1| gi|257062039|ref|YP_003139927.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]