SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257062162|ref|YP_003140050.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257062162|ref|YP_003140050.1|
Domain Number 1 Region: 20-212,313-402
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.43e-90
Family Bacterial dinuclear zinc exopeptidases 0.0000168
Further Details:      
 
Domain Number 2 Region: 196-314
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 6.02e-31
Family Bacterial exopeptidase dimerisation domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257062162|ref|YP_003140050.1|
Sequence length 403
Comment amidohydrolase [Cyanothece sp. PCC 8802]
Sequence
MTLSSLPTISNVNLSQIRLEIRTLQSKLVQWRRHFHQYPELGFKEKATAAFIAQTLTEIG
IPHQTGIAKTGIVATITSPHPGPVLAIRADMDALPIQEENEVPYCSRHDGIMHACGHDGH
TAIALGTADYLWRHREAFRGTVKIIFQPAEESPGGAKPMIEEGVLKNPDVDAIIGLHLWN
NLPLGTVGVRSGPLMAAVECFDLDIFGKGGHGAMPHQTVDSVVVSAQIVNALQTIVARNI
NPIDSAVVTVGELHAGTALNVIADQAKMRGTVRYFNPQFKGYFGQRIEEIVAGICQSFGA
TYELNYWWLYPPVINDEKMAELVRSVALDVVETSTGIVPTCQTMGGEDMSFFLEEVPGCY
FFLGSANPDKGLSYPHHHPRFDFDESVLSMGVEMFVRCVEKFD
Download sequence
Identical sequences WP_015785345.1.62203 395962.Cyan8802_4430 gi|257062162|ref|YP_003140050.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]