SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257058767|ref|YP_003136655.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058767|ref|YP_003136655.1|
Domain Number 1 Region: 13-300
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.72e-54
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 
Domain Number 2 Region: 438-555
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.27e-27
Family Pentapeptide repeats 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257058767|ref|YP_003136655.1|
Sequence length 563
Comment serine/threonine protein kinase with pentapeptide repeats [Cyanothece sp. PCC 8802]
Sequence
MSYCVNPSCTQPKNPNNVQVCQSCGTPLRLNNRYQPLGILGKGGFGATFGAADLSLPGTP
ICVVKQLRPATDDPNVFKMAKELFEREASTLAQVGVHPQVPQLLDYFEQDQQFYLVQEYI
KGHNLHQEIKKNGPLTEAGVKQFLSELLPILQFIHSQKVIHRDIKPANLIRSQKDKKLVL
IDFGAVKNQVNSMVASNNSPQTAFTAFAVGTAGFAPPEQMAMRPVYASDIYAVGVTAVYL
LTGRSPKDIGCDPDTGEIAWEPYVDISDSLSKVLKKMLEISVKHRYKSAEEVLDALAMAP
YEEGMQQSMTTMITGFSSPTSSGKIGLSSGGRSQGEFSTGISRVSMNTEISAKQSHRRTP
EATPISRIHTEVKQPRSIAATTPASAKGPTNWAANGGQGMAQSTKKRRGNTSESTTVETP
TKWKTKTLLSAYQQGRRDFAQQKLENLDLHQANLPGISFYNSCLSRVNLESSELSRADFG
RTSLTDFNGKNANFSEAYFGYADLTGADLRGANLYGANFKYANLTGANLCGADLSFAQIT
PAQLEAAKTNWRTVMPSGKKGFW
Download sequence
Identical sequences WP_015783365.1.62203 395962.Cyan8802_0884 gi|257058767|ref|YP_003136655.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]