SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257091937|ref|YP_003165578.1| from Candidatus Accumulibacter phosphatis clade IIA str. UW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257091937|ref|YP_003165578.1|
Domain Number 1 Region: 135-291,327-521
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 4.19e-70
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00019
Further Details:      
 
Domain Number 2 Region: 8-102
Classification Level Classification E-value
Superfamily Cytochrome c 4.3e-18
Family Quinoprotein alcohol dehydrogenase, C-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257091937|ref|YP_003165578.1|
Sequence length 529
Comment cytochrome d1 heme region [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
Sequence
MTRRQSLAAIALVAALAGTPALVAAAGVQALYREHCSACHGESRLGGIGPALLPENLERL
RKADAVKVIREGRVATQMPAFGDKLNADEAQQLAEWIYSKVSPAPVWGEAEIRNSQVVDA
QAAAQPARPGLGLKGADPLNLFIVVETGDHHVSILDGDRLERVHRFPSRYALHGGPKFSP
DGRFVYFASRDGWITKYDLYNLVVVAEIRAGLNTRNAAVSGDGKWVMVGNYLPHSLVLLD
AKDLSLVKVIPTLDAAGARTSRVSAVYDAAPRQSFIAALKDVPEVWEISYDPDAEAVAEG
LVHDYQYKEGHFKPGMFTPRRTLLQDHLDDFFFTQSYLEILGSSRSTPKGQVIFLDGRKK
IADLDLPGMPHLGSGITWKWTDPAGRERTVMASPNLNEGLVTVIDLGSYQNVRQIRTLGP
GFFMRSHENSRYAFTDSMMSPQHKNTLQVIDKQSLEVVAEIKAQAGQTLAHVEFTRDGRY
ALASLWEMDGALLVIDAQTLKEVKRIPASKPVGKYNVWNKISRSEGTSH
Download sequence
Identical sequences C7RK58
2001017300 2000195740 522306.CAP2UW1_0292 WP_012807099.1.47741 gi|257091937|ref|YP_003165578.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]