SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257093823|ref|YP_003167464.1| from Candidatus Accumulibacter phosphatis clade IIA str. UW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257093823|ref|YP_003167464.1|
Domain Number 1 Region: 84-167
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 1.23e-19
Family TonB 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257093823|ref|YP_003167464.1|
Sequence length 178
Comment TonB family protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
Sequence
MATRLEIRIHGSPDTVLAQPATPTENGASEPESPSGDIAEASHQAPAGTAKADSQLASDT
PDTSPAIELPIDELYFRSSDLDQQPYPLTSVAPSYPPHALLNEIEGWVRLLLMIDETGQI
RHLEVLEGSPPGEFEDAALAAFRFAPFSPGRRGGEAVKSRMIIKVEFKSQDLQSARRE
Download sequence
Identical sequences C7RP53
522306.CAP2UW1_2244 gi|257093823|ref|YP_003167464.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]