SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257094065|ref|YP_003167706.1| from Candidatus Accumulibacter phosphatis clade IIA str. UW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257094065|ref|YP_003167706.1|
Domain Number 1 Region: 130-560
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 1.83e-112
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0000000000376
Further Details:      
 
Domain Number 2 Region: 10-133
Classification Level Classification E-value
Superfamily Cytochrome c 5.3e-20
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257094065|ref|YP_003167706.1|
Sequence length 560
Comment Hydroxylamine reductase [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
Sequence
MQKGIRSVLMLAVLPVAMNLAFAAPAEKAAAPAAAPAAAPAAPTLSAEDKAASGKTYFER
CAGCHGMLRKGATGKNLEPANTTKLGSSRLEKIMSYGTEGGMPNFDDILTKKEIANMAAY
VQMPAEAPPEWSLADIKGSWKLLIPVDKRPTKQMNKVNLANVFAVTLRDSGEVALIDGDT
KKIWVVIKTGYAVHISRMSTSGRYLHVIGRDGRYDLIDLWSETPTTVATLKAGFEARSIE
TTKFKGYEDKYAVVGSYWPPQYTILDGLTLEPLKNVSTRGNTVDGNYHPEPRVASIVASE
SKPEWVINIKETGMIRLVNYSDLANLKETTINSAKFLHDGGWDSSKRYFLVAANASNKVA
VVDTKEGKLAALVDTAKIPHPGRGANFKHPKYGPVWATSHLGADVISVIGTDPAGNPQSA
WKVVQELKNHGANSLFVKTHPKSENLWADAPLNPDPKLAGSVTVYKIADLGNPDPKPEVL
DLAAAADLGKTKGVQRVVHGEYNEKGDEIWFSVWTGNKTEPSAIVVVDDKTRKVKTVIKD
PRLVTPTGKFNVYNTMHDIY
Download sequence
Identical sequences C7RR96
522306.CAP2UW1_2489 2001062690 2000203520 gi|257094065|ref|YP_003167706.1| WP_015766963.1.47741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]