SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257094956|ref|YP_003168597.1| from Candidatus Accumulibacter phosphatis clade IIA str. UW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257094956|ref|YP_003168597.1|
Domain Number 1 Region: 22-382
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 5.75e-74
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257094956|ref|YP_003168597.1|
Sequence length 387
Comment cytochrome d1 heme region [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
Sequence
MNRLFALLWIALLTGCAAPPLRGTGDLGLVIERASGQVTLVDTSRREPYARIGGFGDLSH
ASVVYSRDGRYAYVFGRDGGLTKVDMLTARIVRRVLQSGNAIGGSISQDGRIVVAQNYTP
GGIKAFDAETLELLSEVPAEYAPGSFSKVVGLADLSGNRFAYALFDGGEIWVSDFSDPRR
PRTQRYPAGLQPYDGLVTPDGRYYLAGLFGEDGVALLDTWQPEQGSRRILANYGRGQEKL
PVFKMPHLRGWSLAQGNAYLPAIGRHEVLVVSGSNWREVGRIKVKGQPVFVIARPDGRQV
WVNYAFPDNGWVEVIDTLTGQVVRTLEPGKAILHMEFTPRGEQVWISARDDDKVLIYDTA
TFARIGEFTAQAPSGIFFTSRAGRTGF
Download sequence
Identical sequences C7RJ57
2000176560 522306.CAP2UW1_3408 WP_015767841.1.47741 gi|257094956|ref|YP_003168597.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]