SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229580827|ref|YP_002839226.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229580827|ref|YP_002839226.1|
Domain Number 1 Region: 3-214
Classification Level Classification E-value
Superfamily CbiG N-terminal domain-like 1.01e-47
Family CbiG N-terminal domain-like 0.00000002
Further Details:      
 
Domain Number 2 Region: 208-326
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 5.36e-23
Family CobE/GbiG C-terminal domain-like 0.000000849
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229580827|ref|YP_002839226.1|
Sequence length 329
Comment cobalamin biosynthesis protein CbiG [Sulfolobus islandicus Y.N.15.51]
Sequence
MIENLWRGIAIISASEDGFKAGEIVKEKLKRFEIPVVHFKYKDADIETVWRCYDAIIFVM
ALEGATRIICKYAKSKTKDPAIICIDDKINYVIPLLGGHWGANDIARDLSVILNSTPIIT
TAAELKGKLSVEKIANILVAKILNPENIVKINAVLLRDEYVCVDGVDINVTFPENIRINS
EECNYIVSLRNDKEYKDKIVVWLKPLKISIGVGSKKDVKIDEIRDGIYKVLERLNLKRER
IGIIASIREEVKKIADEINVKFRLVNEEEINNFTNPCLTPPSKTLIEVGLKGVAEISALI
AGGINSKLILRKIAISRNSTIAVATYEGE
Download sequence
Identical sequences C3MJI2 C3N8G3 C3NJQ2
gi|227829126|ref|YP_002830905.1| gi|229577927|ref|YP_002836325.1| WP_012712770.1.13477 WP_012712770.1.52267 WP_012712770.1.66823 gi|229580827|ref|YP_002839226.1| 419942.YN1551_0107 429572.LS215_0107 439386.YG5714_0109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]