SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229580854|ref|YP_002839253.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229580854|ref|YP_002839253.1|
Domain Number 1 Region: 2-180,347-432
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.78e-52
Family Bacterial dinuclear zinc exopeptidases 0.0031
Further Details:      
 
Weak hits

Sequence:  gi|229580854|ref|YP_002839253.1|
Domain Number - Region: 195-232,280-333
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.015
Family Bacterial exopeptidase dimerisation domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229580854|ref|YP_002839253.1|
Sequence length 437
Comment hypothetical protein YN1551_0138 [Sulfolobus islandicus Y.N.15.51]
Sequence
MDEELYTLIEFLKKPSISATGEGIEETANYLKETIEKLLGVKSNIEKTKGHPVVYAEINV
NAKKTLLVYNHYDVQPVDPISEWKRAPFSATIENDRIYARGASDNKGTLMARLFAIKHLI
DKHELNVNVKLLYEGEEEIGSVNLEDYIEKNDNKLKADSVIMEGAGLDPKGRPQIVLGVK
GLLYVELVLDYGTKDLHSSNAPLVRNPCIDLSKVISTLVDMEGRVLIEGFYNDVRELTEE
ERELIKKYDIDVEELRKALGFKELRYSDREKIAEALLTYPTCNIDGFECGYTGKGSKTIV
PHRAFAKLDFRLVPNQDPYKIFELLKKHLQKVGFNGEIITHGFEYPVRTSVNSPVVKAMI
ESARRVYGTEPQVIPNSAGTQPMGLFVYKLGIRDAVSAIGAGGYYSNAHAPNENIRIDDY
YKAIKHTEEFLKLYSTL
Download sequence
Identical sequences C3NBU1 C3NJS9
gi|229580854|ref|YP_002839253.1| 419942.YN1551_0138 439386.YG5714_2752 gi|229580498|ref|YP_002838898.1| WP_012716799.1.13477 WP_012716799.1.52267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]