SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229580941|ref|YP_002839340.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229580941|ref|YP_002839340.1|
Domain Number 1 Region: 96-248
Classification Level Classification E-value
Superfamily TPR-like 5.31e-26
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 
Domain Number 2 Region: 7-117
Classification Level Classification E-value
Superfamily TPR-like 6.32e-16
Family Tetratricopeptide repeat (TPR) 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229580941|ref|YP_002839340.1|
Sequence length 274
Comment hypothetical protein YN1551_0233 [Sulfolobus islandicus Y.N.15.51]
Sequence
MEDVIKQAEELLEKGRYNEVLKVLENFESVEVYLLRAEAYLRMSNSKAALVELDKGVQTF
PFSYAILSAKAEVLENEGRLEEALENINKALEILPFSSEYRFIKARILFKLERYEEANIE
LTEVSRLNPNNVDARVMKAFCYYNMGLKLDALSEINRALNVKKEDSSLHELKGKIYFETG
FYKLALSEFKIAAHYDPNNPDHYYNAAACYYNLKMYNDALTYMDLALSKGEKANYHILKA
LILKELNMEFSQEVEEAIKLDPSIKSIIENLFKK
Download sequence
Identical sequences C3NKD8
419942.YN1551_0233 gi|229580941|ref|YP_002839340.1| WP_012717028.1.52267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]