SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229581088|ref|YP_002839487.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581088|ref|YP_002839487.1|
Domain Number 1 Region: 1-191
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.26e-37
Family GHMP Kinase, N-terminal domain 0.0016
Further Details:      
 
Domain Number 2 Region: 177-311
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 7.44e-19
Family Phosphomevalonate kinase (PMK) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229581088|ref|YP_002839487.1|
Sequence length 322
Comment GHMP kinase [Sulfolobus islandicus Y.N.15.51]
Sequence
MIRISAPGKILWIGSYSVVFGGISHVIAVNKRVSCRLREIQERSLIFHTSYGDFKNSGNE
LINSVLDTFRERFTQLPQGYEIELYNDKEFILDGKKTGLGSSSAATVSLTACLYYAINGK
LDLFEIHKLAQIANFKRQKGIGSGFDIASAVFGSIVYKRFTDLEKMDFYYEKLKLGNYDM
VLGFTGKSSETVGLVKKFVEKSNLEDFREIMRLIDEENNMAIRLVKLNKIDEAVEHVRLG
RKYLNYIAERIVGVKLVSKEEEELIKIAEDEGALIALSPGAGGGDSIFALGNDLSKVREA
WKRRGIITIDVKENEGLKLDSN
Download sequence
Identical sequences C3ML88 C3NAF1 C3NL51 D2PGE4 F0NCT1
419942.YN1551_0396 429572.LS215_2536 439386.YG5714_2510 gi|229581088|ref|YP_002839487.1| gi|229580266|ref|YP_002838666.1| WP_012714386.1.13477 WP_012714386.1.34992 WP_012714386.1.52267 WP_012714386.1.66823 WP_012714386.1.67233 gi|385776951|ref|YP_005649519.1| gi|227831355|ref|YP_002833135.1| gi|284998886|ref|YP_003420654.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]