SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229581627|ref|YP_002840026.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581627|ref|YP_002840026.1|
Domain Number 1 Region: 47-111
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 2.15e-22
Family Transcriptional factor domain 0.0012
Further Details:      
 
Domain Number 2 Region: 1-39
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00000187
Family Transcriptional factor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229581627|ref|YP_002840026.1|
Sequence length 111
Comment transcription termination factor Tfs [Sulfolobus islandicus Y.N.15.51]
Sequence
MKFCPKCNSMMVPKKSNGKNIYRCTKCGYEEEVPETTIVVTSKVKHSIKEKTLILEEEEM
PSGAQKIKGVLCPSCKNDEAYFWILQTRRADEPPTRFYKCTKCGKVWREYE
Download sequence
Identical sequences C3NFY6
419942.YN1551_0997 gi|229581627|ref|YP_002840026.1| WP_012717300.1.52267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]