SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229581644|ref|YP_002840043.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581644|ref|YP_002840043.1|
Domain Number 1 Region: 17-152
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000000000395
Family GHMP Kinase, N-terminal domain 0.0054
Further Details:      
 
Domain Number 2 Region: 207-251
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00000369
Family Homoserine kinase 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229581644|ref|YP_002840043.1|
Sequence length 268
Comment shikimate kinase [Sulfolobus islandicus Y.N.15.51]
Sequence
MQTYGGVSIINALPSWYGSSMAVNLKVKVEIKEGKRDYSKESDLIRVIIDYFKEKYSIPD
IVVDIESELPQKSGLKSSSAVSVALIAEIAKRYNLRNINPPVLSAILSLKAGVSYTGALD
DATASYCGGIAFTYNKMFRIVKLDNPEDDLSVLILARGGRQKSVNLNELRKYNHVFEEIF
RIALKDSLTAMKINGILIANILGYPLDLIEIALKNGALAAGISGNGPSYFAVSRYGEEGP
IYESLKRFGDVIIARPVSLDCKDLSIRD
Download sequence
Identical sequences C3NG03
WP_012717307.1.52267 419942.YN1551_1014 gi|229581644|ref|YP_002840043.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]