SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229581651|ref|YP_002840050.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581651|ref|YP_002840050.1|
Domain Number 1 Region: 1-70
Classification Level Classification E-value
Superfamily SirA-like 0.00000000327
Family SirA-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229581651|ref|YP_002840050.1|
Sequence length 72
Comment hypothetical protein YN1551_1021 [Sulfolobus islandicus Y.N.15.51]
Sequence
MEKLDLRGKPCEEFILEISKYLVAMKVGDSILVLTDKDRVLCTHQLLRNAPRYLFKADVV
DDYAEITIKRLR
Download sequence
Identical sequences C3MRA9 C3MXJ8 C3MZE4 C3N7G6 C3NG10 C4KIM4 D2PDC9 F0NIG0 F0NRG0 M9UAL2
419942.YN1551_1021 426118.M164_1835 427317.M1425_1787 427318.M1627_1905 429572.LS215_1927 439386.YG5714_1904 gi|238620280|ref|YP_002915106.1| gi|227828050|ref|YP_002829830.1| gi|385776393|ref|YP_005648961.1| gi|229579683|ref|YP_002838082.1| gi|227830787|ref|YP_002832567.1| gi|284998301|ref|YP_003420069.1| gi|229585319|ref|YP_002843821.1| WP_012711762.1.100559 WP_012711762.1.13477 WP_012711762.1.27011 WP_012711762.1.27461 WP_012711762.1.34992 WP_012711762.1.44962 WP_012711762.1.47130 WP_012711762.1.48461 WP_012711762.1.52267 WP_012711762.1.60638 WP_012711762.1.66823 WP_012711762.1.67233 WP_012711762.1.68242 WP_012711762.1.74483 WP_012711762.1.83431 WP_012711762.1.84481 WP_012711762.1.89621 WP_012711762.1.90709 WP_012711762.1.91160 WP_012711762.1.97021 gi|479326073|ref|YP_007866128.1| gi|385773758|ref|YP_005646325.1| gi|229581651|ref|YP_002840050.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]