SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229581682|ref|YP_002840081.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581682|ref|YP_002840081.1|
Domain Number 1 Region: 10-140
Classification Level Classification E-value
Superfamily Prefoldin 5.89e-19
Family Prefoldin 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229581682|ref|YP_002840081.1|
Sequence length 147
Comment prefoldin subunit alpha [Sulfolobus islandicus Y.N.15.51]
Sequence
MSQGQGGITLDDLIAQADYLKRYIDSLQRTQLELLESINSIDSAKQAIETIKSGNKEMLV
FIDRKGYLLAKVGGVVGDKVTVHLGLSYYAEVDLDSAIKILDKRKDEISKAAQNLNNELQ
KAASTYNQIVDILNQIQQAAARRQQGE
Download sequence
Identical sequences C3NG99
gi|229581682|ref|YP_002840081.1| 419942.YN1551_1052 WP_012717317.1.52267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]