SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229581706|ref|YP_002840105.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581706|ref|YP_002840105.1|
Domain Number 1 Region: 58-129
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000077
Family GHMP Kinase, N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229581706|ref|YP_002840105.1|
Sequence length 292
Comment beta-ribofuranosylaminobenzene 5'-phosphate synthase [Sulfolobus islandicus Y.N.15.51]
Sequence
MIKIIGLSRIHITLFDLEGKYGRIDGGVGVALKYPRIVVRSGNCFKPEVSLPFEVPKMCI
EEDFEEHIGLGHTTQYLLSVAKLSAEYNFKRLSSYELAKLVKRGGTSGVGVYAFDYGGFI
VDGGHSTKVKRELLPSDFSSAPPPPLIARLNFPWYIYVNVLKGGRRIFGKDEIKAFKEAK
LEGLDTLARVVLMELIPSVAEKDLEGTLDAISLIQNLGFKKVEVSLQADEVKKLMNDMAK
IGFPAGLSSFGPAVYTFVSSKREGEELISRFDGFISEPNNEGAKVFWSTINS
Download sequence
Identical sequences C3MR56 C3MXE5 C3MZ91 C3NGC3 C4KIG9 F0NPZ9 M9UAF9
gi|385773704|ref|YP_005646271.1| gi|227827997|ref|YP_002829777.1| gi|229585266|ref|YP_002843768.1| 419942.YN1551_1076 426118.M164_1780 427317.M1425_1733 427318.M1627_1851 429572.LS215_1873 WP_012711710.1.100559 WP_012711710.1.27011 WP_012711710.1.27461 WP_012711710.1.44962 WP_012711710.1.47130 WP_012711710.1.48461 WP_012711710.1.52267 WP_012711710.1.60638 WP_012711710.1.66823 WP_012711710.1.68242 WP_012711710.1.74483 WP_012711710.1.83431 WP_012711710.1.84481 WP_012711710.1.90709 WP_012711710.1.91160 WP_012711710.1.97021 gi|227830734|ref|YP_002832514.1| gi|229581706|ref|YP_002840105.1| gi|238620225|ref|YP_002915051.1| gi|479326018|ref|YP_007866073.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]