SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229581920|ref|YP_002840319.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581920|ref|YP_002840319.1|
Domain Number 1 Region: 171-438
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.56e-77
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000102
Further Details:      
 
Domain Number 2 Region: 7-113
Classification Level Classification E-value
Superfamily tRNA-binding arm 2.51e-22
Family Seryl-tRNA synthetase (SerRS) 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229581920|ref|YP_002840319.1|
Sequence length 457
Comment seryl-tRNA synthetase [Sulfolobus islandicus Y.N.15.51]
Sequence
MSWSILEFLRKNPEELKNNLKRRAIDVSLVDKAVELDKKWRQVLQEVERLRHQHNVLSSQ
IPKLSGEERKKKIEESKNLLKILEDKEKELEKIEVERDRLLSSLPNLVADDVPNGPDDSY
NIPIKFWGKFKVYEGDVEEFLRQTKDANVNYEIIKWKPKGHAEMLEDVLHLGNTLKAAEI
AGSRFYYLFNDIVWLDFALLLFAIDYITQQGYTLVLPPYMLRGEVIQSVIDLDTFKDAIY
KIENEDLYLIATAEHSIAAMFFKEEIEKDKLPLKFAGISPAFRKEAGAANKDLKGIFRVH
QFHKVEQFIFSTPEDSWKYHAELITNAESIFQQLELPYRIVNIASGDLGACAAKKFDLEV
WMPAQAKFREMVSCSNCTDWQAFRMKIRYVDRKNNKRGYVHTLNSTAIASTRTITAILEN
YQREDGVVEVPKVLRKYLEIFPKAPKDYIYPLKNKII
Download sequence
Identical sequences C3MQH9 C3N6A0 C3NGY7 C4KHR4 D2PCH9
WP_012713805.1.27461 WP_012713805.1.34992 WP_012713805.1.44962 WP_012713805.1.47130 WP_012713805.1.48461 WP_012713805.1.52267 WP_012713805.1.66823 WP_012713805.1.74483 WP_012713805.1.83431 WP_012713805.1.84481 WP_012713805.1.90709 WP_012713805.1.97021 gi|229581920|ref|YP_002840319.1| gi|229585068|ref|YP_002843570.1| 419942.YN1551_1302 426118.M164_1527 427318.M1627_1645 429572.LS215_1638 gi|238619970|ref|YP_002914796.1| gi|227830507|ref|YP_002832287.1| gi|284998002|ref|YP_003419769.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]