SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229582049|ref|YP_002840448.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229582049|ref|YP_002840448.1|
Domain Number 1 Region: 6-263
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.2e-70
Family G proteins 0.00000355
Further Details:      
 
Domain Number 2 Region: 469-629
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.08e-52
Family Translational machinery components 0.0000328
Further Details:      
 
Domain Number 3 Region: 261-377
Classification Level Classification E-value
Superfamily Translation proteins 7.27e-29
Family Elongation factors 0.001
Further Details:      
 
Domain Number 4 Region: 630-723
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.93e-22
Family EF-G/eEF-2 domains III and V 0.002
Further Details:      
 
Domain Number 5 Region: 393-469
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 7.19e-22
Family EF-G/eEF-2 domains III and V 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229582049|ref|YP_002840448.1|
Sequence length 736
Comment elongation factor EF-2 [Sulfolobus islandicus Y.N.15.51]
Sequence
MPRYKTVEQVLSLMKDRTRVRNIGIIAHVDHGKTTTSDTLLAASGIISPKVAGEALALDY
LSVEQQRGITVKAANISLYHEAEGKGYVINLIDTPGHVDFSGRVTRSLRVLDGSIVVVDA
VEGIMTQTETVLRQSLEERVRPILFINKVDRLVKELKLSPQEMLNRLLDIIRQVNNLIDM
YGEPEFKEKWMINPQAGNVIFGSAKDKWGFSLPMAQKKGINMKNVIDAYTASDKSKLEEL
AAQAPINEALLDAAIKFVPNPIEAQKYRIPKIWKGDLDNELAKAMLNADPNGPIVFMITD
MKVDPHAGLVATGRVFSGTLRSGEELWLVNAKTSQRILQVSLYMGPTRELAEEIPAGNIA
AVLGLDRARSGETAISVGFSNVQGSFERLHYISEPVVTIAVEPKNPKDLTKMIDALRKLS
IEDPNLVVKINEETGEYLLSGMGFLHLEVSLQLLRENYGIDVVTTPPIVVYRESIRAKSQ
VFEGKSPNKHNKFYLSVEPLNDKTIELISNGTIREDMDSKEMAKILRDEASWDYDEAKRI
IAIDENVNVFVDLTSGVQHLREVMDTVLQGFRLAMKEGPLAHEPIRGVKVILHDAVIHED
PAHRGPAQIYPAVRNSIFAGFLTSRPTLLEPIQKLDIRVPADLIGNVTAVITRKRGKILD
VSQIANMSRITAEIPVSESYDMASELRGSTGGRAFWGTEFSRWAPVPDSILLDVVTKIRE
RKGLPKELPKVEDFLS
Download sequence
Identical sequences C3MQ53 C3MVH1 C3N5S0 C3NED6 C3NHB6 C4KHE9 D2PC64 F0NF68 F0NM25
gi|284997887|ref|YP_003419654.1| gi|227830381|ref|YP_002832161.1| gi|229579199|ref|YP_002837597.1| gi|229584888|ref|YP_002843390.1| gi|229582049|ref|YP_002840448.1| WP_012711411.1.100559 WP_012711411.1.13477 WP_012711411.1.27011 WP_012711411.1.27461 WP_012711411.1.34992 WP_012711411.1.44962 WP_012711411.1.47130 WP_012711411.1.48461 WP_012711411.1.52267 WP_012711411.1.60638 WP_012711411.1.66823 WP_012711411.1.67233 WP_012711411.1.68242 WP_012711411.1.74483 WP_012711411.1.83431 WP_012711411.1.84481 WP_012711411.1.89621 WP_012711411.1.90709 WP_012711411.1.91160 WP_012711411.1.97021 gi|385773356|ref|YP_005645922.1| gi|238619855|ref|YP_002914681.1| gi|227827684|ref|YP_002829464.1| gi|385775994|ref|YP_005648562.1| 419942.YN1551_1435 426118.M164_1407 427317.M1425_1413 427318.M1627_1463 429572.LS215_1508 439386.YG5714_1408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]