SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229582056|ref|YP_002840455.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229582056|ref|YP_002840455.1|
Domain Number 1 Region: 8-180
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.47e-46
Family Ribonuclease PH domain 1-like 0.000000168
Further Details:      
 
Domain Number 2 Region: 153-240
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.8e-24
Family Ribonuclease PH domain 2-like 0.0000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229582056|ref|YP_002840455.1|
Sequence length 245
Comment exosome complex exonuclease Rrp41 [Sulfolobus islandicus Y.N.15.51]
Sequence
MLQVERPKLILEDGKRIDGRKPDELRSIKIELGVLKNADGSAIFEMGNTKAIAAVYGPKE
MHPRHLSLPDRAVLRVRYHMTPFSTDERKNPAPSRREIELSKVIREALESAVLVELFPRT
AIDVFTEILQADAGSRLVSLMAASLALADAGIPMRDLIAGVAVGKADGVIVLDLNEPEDM
WGEADMPVAMMPSLNQVTLFQLNGNMTPEEFRQAFDLSVKGINIIYNLEREALKSKYVEF
KEEGV
Download sequence
Identical sequences C3MQ46 C3NEC9 C3NHC3 D2PC57
gi|229579192|ref|YP_002837590.1| gi|229582056|ref|YP_002840455.1| gi|227830374|ref|YP_002832154.1| WP_012713727.1.13477 WP_012713727.1.34992 WP_012713727.1.52267 WP_012713727.1.66823 419942.YN1551_1442 429572.LS215_1501 439386.YG5714_1401 gi|284997880|ref|YP_003419647.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]