SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229582219|ref|YP_002840618.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229582219|ref|YP_002840618.1|
Domain Number 1 Region: 308-468
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.88e-65
Family DNA gyrase/MutL, second domain 0.0000000312
Further Details:      
 
Domain Number 2 Region: 14-227
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.57e-41
Family DNA gyrase/MutL, N-terminal domain 0.00000000281
Further Details:      
 
Domain Number 3 Region: 230-303
Classification Level Classification E-value
Superfamily S13-like H2TH domain 3.4e-17
Family Topoisomerase VI-B subunit middle domain 0.0000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229582219|ref|YP_002840618.1|
Sequence length 530
Comment DNA topoisomerase VI subunit B [Sulfolobus islandicus Y.N.15.51]
Sequence
MSAKEKFTSLSPAEFFKRNPELAGFPNPARALYQTVRELIENSLDATDVHGILPNIKITI
DLIDEARQIYKVNVVDNGIGIPPQEVPNAFGRVLYSSKYANRQTRGMYGLGVKAAVLYSQ
MHQDKPIEIETSPANSKRIYTFKLKIDINKNEPIIVERGSVENTRGFHGTSVAISIPGDW
PKAKSRIYEYIKRTYIITPYAEFIFKDPEGNVTYYPRLTNKIPKPPQEVKPHPYGVDREE
IKILINNLKRDYTIKEFLVNEFQSIGDTTADKILELAGLKPNKKVKNLTEEEITRLVETF
KKYEDFRSPSADSLSVIGEDLIELGLKKIFNPDFAASITRKPKAYQGHPFIVEAGVAFGG
SIPVGEEPIVLRYANKIPLIYDEKSDVIWKVVEELDWKRYGIESDQYQMVVMVHLCSTKI
PYKSAGKESIAEVEDIEKEIKNALMEVARKLKQYLSEKRKEQEAKKKLLAYLKYIPEVSR
SLATFLASGNKELVSKYQNEISEGLFKLISKKLDLINIEEYRKVYRVDNE
Download sequence
Identical sequences C3NHT6
419942.YN1551_1608 gi|229582219|ref|YP_002840618.1| WP_012717515.1.52267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]