SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229582232|ref|YP_002840631.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229582232|ref|YP_002840631.1|
Domain Number 1 Region: 1-68,150-319
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 9.42e-75
Family Pyruvate kinase 0.0000362
Further Details:      
 
Domain Number 2 Region: 302-447
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 6.41e-26
Family Pyruvate kinase, C-terminal domain 0.0097
Further Details:      
 
Domain Number 3 Region: 63-149
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 4.54e-18
Family Pyruvate kinase beta-barrel domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229582232|ref|YP_002840631.1|
Sequence length 449
Comment pyruvate kinase [Sulfolobus islandicus Y.N.15.51]
Sequence
MRKTKIVATLGPSSEEKVKELAEYVDVFRINFAHGDEKSHKKYFDLIRTYAPESSILVDL
PGPKLRLGELKEPIEVKKGDKIIFSQKDGIPVDDELFYSAVKENSYILIADGTIRVRVTS
KSKDKVEGIVVEGGILLSRKGINIPNVSLKSGITDNDLKLLKRALDLGADYIGLSFVISE
DDVKKVKEFVKDEAWIIAKIEKSEALKNLTNIVKESDGIMVARGDLGVETGLENLPLIQR
RIVRISRVFGKPVILATQVLTSMINSPIPTRAEIIDISNSIMQGVDSIMLSDETAIGNYP
VESVRTLHNIISNVEKSIKHGPIGPLNSESDAIALAAVNASKISKADVIVVYSRSGNSIL
RVSRLRPERNIIGISPDPKLSKKFKLCYGVIPLSISKKMESIDEIIDVSTKLMEKKVKDL
RFKKIVIVGGDPKQEAGKTNFVIVKTLEQ
Download sequence
Identical sequences C3MPM4 C3NDV4 C3NHU9 D2PJR8
gi|229579017|ref|YP_002837415.1| 419942.YN1551_1621 429572.LS215_1329 439386.YG5714_1227 gi|227830202|ref|YP_002831982.1| gi|284997624|ref|YP_003419391.1| gi|229582232|ref|YP_002840631.1| WP_012713648.1.13477 WP_012713648.1.34992 WP_012713648.1.52267 WP_012713648.1.66823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]