SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229582325|ref|YP_002840724.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229582325|ref|YP_002840724.1|
Domain Number 1 Region: 65-205
Classification Level Classification E-value
Superfamily SMAD/FHA domain 5.74e-24
Family FHA domain 0.0023
Further Details:      
 
Weak hits

Sequence:  gi|229582325|ref|YP_002840724.1|
Domain Number - Region: 2-27
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0017
Family Ran binding protein zinc finger-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229582325|ref|YP_002840724.1|
Sequence length 208
Comment FHA domain-containing protein [Sulfolobus islandicus Y.N.15.51]
Sequence
MTWKCPVCGYENADDSLFCIKCGTKKPEQQAEQAPVPSVENQASGQQSVEQQSAAEQQLV
QQSTTSEQQPVAEQQTPQQVVVEQPSEPKLEQPQPAATTVSKYYLLFINTPNPAFNKTKL
PLDFDIFPSISIGRSPENVIVIPDPEVSRKHAIISFENNELYLEDLNSTNGTYIYDGKVF
QPVKGKVRVQPNSIIKLGNNTVVRIVGE
Download sequence
Identical sequences C3NI42
WP_012717548.1.52267 gi|229582325|ref|YP_002840724.1| 419942.YN1551_1726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]