SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229582561|ref|YP_002840960.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229582561|ref|YP_002840960.1|
Domain Number 1 Region: 167-292
Classification Level Classification E-value
Superfamily vWA-like 0.000000000207
Family Integrin A (or I) domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229582561|ref|YP_002840960.1|
Sequence length 329
Comment VWA containing CoxE family protein [Sulfolobus islandicus Y.N.15.51]
Sequence
MEERIAIVKIANILRQMGRNVGIDETIDALRALELIRDKDLDTIRAILKATLIKDFTLLE
SNKREEEKNSVIGKITQSNYLAAEYYIYSRIESKAKLPSFIITNSDLIKWSKIAKYVEEI
TLNYKGRRFKPKDKGEIDMRRTIRSETKYSMESPYLLKSVRKINKSNLILLCDVSGSMKD
FFKETILLSFFIKRNIPKSEIFHFSTDLRRVTNLFQVTSIYKVNVRKLALAVSYGSGTKI
GEALYMLRRNFGDLIHHNNSILIFSDGWDLGDLELLDREMRIIKRRCKKIVWMNPLLDEL
HPPETSGMKIALKYVDLLLSPDIKKSLSY
Download sequence
Identical sequences C3NIS8
419942.YN1551_2001 gi|229582561|ref|YP_002840960.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]