SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229582562|ref|YP_002840961.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229582562|ref|YP_002840961.1|
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily SirA-like 0.00000000000000615
Family SirA-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229582562|ref|YP_002840961.1|
Sequence length 77
Comment SirA family protein [Sulfolobus islandicus Y.N.15.51]
Sequence
MSSLKIYKELDLTSSSCAGPIGELSSVVDELREGEAVKVILGDEATKKDITLWVKKRGLK
LIQESQEGNKYILLIGK
Download sequence
Identical sequences C3NCB7 C3NIS9
WP_012715909.1.13477 WP_012715909.1.52267 gi|229582562|ref|YP_002840961.1| gi|229578649|ref|YP_002837047.1| 2013581946 419942.YN1551_2002 439386.YG5714_0845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]