SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229582972|ref|YP_002841371.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229582972|ref|YP_002841371.1|
Domain Number 1 Region: 5-203,305-391
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.26e-87
Family Bacterial dinuclear zinc exopeptidases 0.00000569
Further Details:      
 
Domain Number 2 Region: 190-297
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 3.27e-29
Family Bacterial exopeptidase dimerisation domain 0.000088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229582972|ref|YP_002841371.1|
Sequence length 393
Comment amidohydrolase [Sulfolobus islandicus Y.N.15.51]
Sequence
MDLVEKLKNDVKEIEDWIIQIRRKIHENPELSYKEYSTSKLVAETLRKLGIEVEEGVGLP
TAVVGKIRGNKPGKTVALRADMDALPVEETSDVEFRSKVKGVMHACGHDTHVAMLLGGAY
LLVKNKDLISGEIRLIFQPAEEDGGLGGAKPMIEAGVMNGVDYVFGIHISSSYPSGVFAT
RKGPIMATPDAFKIVVHGKGGHGSAPHETIDPIFVSLQIANAIYGITARQIDPVQPFVIS
ITTIHSGTKDNIIPDDAEMQGTIRSLDENVRSKAKDYMRRIVSSVCGIYGATCEVKFMED
VYPITVNNPEVTDEVMKILSSISTVVETEPVLGAEDFSRFLQKAPGTYFFLGTRNEKKGC
IYPNHSSKFCVDEDVLKLGALAHALLAIKFSNK
Download sequence
Identical sequences C3NKX6
419942.YN1551_2498 gi|229582972|ref|YP_002841371.1| WP_012717966.1.52267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]