SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229582995|ref|YP_002841394.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229582995|ref|YP_002841394.1|
Domain Number 1 Region: 7-116,157-285
Classification Level Classification E-value
Superfamily Aquaporin-like 3.79e-47
Family Aquaporin-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229582995|ref|YP_002841394.1|
Sequence length 289
Comment major intrinsic protein [Sulfolobus islandicus Y.N.15.51]
Sequence
MSVVLKDSLWRYFAEFVGTFILILFGDGAIVASTLSSQPSFGFIMVSWGFGIVSAIYAVG
PISGAHINPNVTLAFAVTKRIKWVDVIPYIVFQILGAAAATSVLLVWWGDVITRIDPPPF
LYADIGAAFFTQYPEPGFWPQYWPKSYLPNVSSAGILYSQVNQIFPLWKGAFAEALMTFL
LLLIVVAVTDPDSPFYSQSLAPWAIGIGYVMPSLLFEAQLTGGMINEARSWGPMLALYLI
GYRTGAFNFRGEYFYVYGIPDFIGGILGALFWDHVLKPYLRFVKNINKK
Download sequence
Identical sequences C3NAM1 C3NKZ9
gi|229578305|ref|YP_002836703.1| gi|229582995|ref|YP_002841394.1| 419942.YN1551_2523 439386.YG5714_0487 WP_012715638.1.13477 WP_012715638.1.52267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]