SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229583006|ref|YP_002841405.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229583006|ref|YP_002841405.1|
Domain Number 1 Region: 6-43
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000476
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229583006|ref|YP_002841405.1|
Sequence length 63
Comment zinc finger C2H2-type domain-containing protein [Sulfolobus islandicus Y.N.15.51]
Sequence
MGIIGPYVCPLCLMPFNSSVSLKQHIRYTEHAKTCPICKKKFRNTDSTLDHVCKKHNISA
LVR
Download sequence
Identical sequences C3NL10
WP_012717977.1.52267 419942.YN1551_2539 gi|229583006|ref|YP_002841405.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]