SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229583456|ref|YP_002841855.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229583456|ref|YP_002841855.1|
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily SirA-like 0.0000000000000392
Family SirA-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229583456|ref|YP_002841855.1|
Sequence length 77
Comment SirA family protein [Sulfolobus islandicus Y.N.15.51]
Sequence
MSSLKIYKELDLTSSSCAGPIGELSSVVDELREGEAVKVILGDDATKKDITLWSKKRGLK
IVQESQEGSKYVLLISK
Download sequence
Identical sequences C3MMR3 C3MT99 C3N3K0 C3NCH2 C3NFJ9 C4KEZ7
gi|229586117|ref|YP_002844619.1| gi|238621102|ref|YP_002915928.1| gi|227831645|ref|YP_002833425.1| gi|229580600|ref|YP_002839000.1| gi|227828910|ref|YP_002830690.1| 419942.YN1551_3046 426118.M164_2668 427317.M1425_2683 427318.M1627_2737 429572.LS215_2845 439386.YG5714_2859 WP_012712595.1.100559 WP_012712595.1.13477 WP_012712595.1.27011 WP_012712595.1.27461 WP_012712595.1.44962 WP_012712595.1.47130 WP_012712595.1.48461 WP_012712595.1.52267 WP_012712595.1.60638 WP_012712595.1.66823 WP_012712595.1.67233 WP_012712595.1.68242 WP_012712595.1.74483 WP_012712595.1.83431 WP_012712595.1.84481 WP_012712595.1.89621 WP_012712595.1.90709 WP_012712595.1.97021 gi|229583456|ref|YP_002841855.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]