SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229581478|ref|YP_002839877.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581478|ref|YP_002839877.1|
Domain Number 1 Region: 11-190,252-370
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.87e-50
Family tRNA pseudouridine synthase TruD 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229581478|ref|YP_002839877.1|
Sequence length 377
Comment tRNA pseudouridine synthase D TruD [Sulfolobus islandicus Y.N.15.51]
Sequence
MIPHEIDIALGMERYYYEDWNEIDGTIERPNGFKVVEEIDFKPAHEWKGEEKGKYAVYLL
TKWGIDHFSVLSEIQKVLHSKVNYMGIKDASAITSQLVYITLTKKQELINEYKSNSFILK
FLGYSSMKFNHTGNIFEISLSTSNFDLVVERVRQIEKNPYLPAFIGYQRFGTRRPVTHLI
GKYLLKRDWEKAFYLILTYPFLSESKEIIEIRKLIIKGDFNEAVRLIPSKFKQEKLLLKN
YMKFNSYYLALKNSFIPISLYLDAYQSYLFNMYLSRRLDKYKNSDDKDNLFIRIPIYFND
CDDICKEIYLNEEIEKNFFKLPEFKISLKSLNRKAFMNIRNLKINEETRTISFVLDRGMY
ATVLLREILRGDPRKFT
Download sequence
Identical sequences C3MJ31 C3MYS3 C3MZS8 C3N852 C3NF59 D2PE37 F0NI14 F0NQ52
WP_012711934.1.13477 WP_012711934.1.27011 WP_012711934.1.27461 WP_012711934.1.34992 WP_012711934.1.47130 WP_012711934.1.52267 WP_012711934.1.60638 WP_012711934.1.66823 WP_012711934.1.67233 WP_012711934.1.68242 WP_012711934.1.74483 WP_012711934.1.83431 WP_012711934.1.84481 WP_012711934.1.89621 WP_012711934.1.90709 gi|227830983|ref|YP_002832763.1| gi|284998472|ref|YP_003420240.1| gi|227828225|ref|YP_002830005.1| 419942.YN1551_0833 427317.M1425_1963 427318.M1627_2041 429572.LS215_2126 439386.YG5714_2085 gi|229579862|ref|YP_002838261.1| gi|385776544|ref|YP_005649112.1| gi|385773902|ref|YP_005646469.1| gi|229585453|ref|YP_002843955.1| gi|229581478|ref|YP_002839877.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]