SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229582828|ref|YP_002841227.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|229582828|ref|YP_002841227.1|
Domain Number - Region: 11-72
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0756
Family Calponin-homology domain, CH-domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229582828|ref|YP_002841227.1|
Sequence length 217
Comment hypothetical protein YN1551_2327 [Sulfolobus islandicus Y.N.15.51]
Sequence
MKNKVSIVLSICILLLLPIIFPDTYPFSPFNIGSQGISYFYNNFENITSSNVTILILMEN
INNVNPYLIYLLEGNTIIITGNYSNVNNFLHKLNADVIIAPIVLTNNLDYYMNNKIIIVN
ESNYTLIFPYAHPIIGGIPLVEVDNNSIIAYYHYGSGKIIIISTPYFFLNSYYKLFNNSE
YLHEITGTNKIRIVIYTQVSPLSEFKEFLQSLKSLHL
Download sequence
Identical sequences C3NK62
gi|229582828|ref|YP_002841227.1| WP_012717865.1.52267 419942.YN1551_2327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]