SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229917897|ref|YP_002886543.1| from Exiguobacterium sp. AT1b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229917897|ref|YP_002886543.1|
Domain Number 1 Region: 190-355
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.21e-29
Family Histidine kinase 0.0038
Further Details:      
 
Domain Number 2 Region: 120-201
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000137
Family Homodimeric domain of signal transducing histidine kinase 0.0016
Further Details:      
 
Domain Number 3 Region: 77-126
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000889
Family HAMP domain 0.0055
Further Details:      
 
Weak hits

Sequence:  gi|229917897|ref|YP_002886543.1|
Domain Number - Region: 9-80
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0211
Family Rhodopsin-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229917897|ref|YP_002886543.1|
Sequence length 362
Comment histidine kinase [Exiguobacterium sp. AT1b]
Sequence
MRRRQWDRLLVKLIGIILVNALIATIAFLIMGYSISLYYIENETTPDPLTSNLMFLGVTF
IVILIFIIGFSLMMRKTLRKITYLSSEIEQIANGDLGRTVKVEGRDEIASLGESVNRMSA
QLSELFEKERAHEEERNQLFSNLSHDLRTPLTSIKGYTQLLQMNRELTAEENNHFRILNE
KTAQLEHLLDQLMDVNRLYAPHMQLKKQKLNLSLLTTQLIHEMEPLFKERGHRLHLSIQS
DRWIEADQEQLIRVFENLFSNTWKYAEQTSPIEIRLQTKGQQIEWSISNATTAETIEAIP
HLFDRTYRVDSSRGVTPGDGLGLSIARQIILLHGGQLTAEPLEGQIICFRVSFPTHQHIE
RE
Download sequence
Identical sequences C4L1R6
WP_015880657.1.32866 WP_015880657.1.48863 360911.EAT1b_2175 gi|229917897|ref|YP_002886543.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]