SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|254804781|ref|YP_003083002.1| from Neisseria meningitidis alpha14

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|254804781|ref|YP_003083002.1|
Domain Number - Region: 6-92
Classification Level Classification E-value
Superfamily Phage tail protein-like 0.000225
Family Lambda phage gpU-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|254804781|ref|YP_003083002.1|
Sequence length 139
Comment putative phage associated protein [Neisseria meningitidis alpha14]
Sequence
MTSRLTEIRNAATDVLKTKFQRVYSGRGFAPAQSQLPCVVVYVDRRRTEQETFDFPPTYR
HTVRLVTLVCVQAASGADELAEEMLSLIGQLFAEHSDLGVGDLENLVPDLLNIDSDESGE
AVTVYYQQGWQAVYFEQAV
Download sequence
Identical sequences C6S6G8
WP_015815470.1.82858 gi|254804781|ref|YP_003083002.1| 662598.NMO_0794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]