SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|254804906|ref|YP_003083127.1| from Neisseria meningitidis alpha14

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|254804906|ref|YP_003083127.1|
Domain Number 1 Region: 3-135
Classification Level Classification E-value
Superfamily Phage tail protein-like 2.35e-42
Family STM4215-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|254804906|ref|YP_003083127.1|
Sequence length 165
Comment putative phage associated protein [Neisseria meningitidis alpha14]
Sequence
MSTTRPIIDAVVEHLQAAIPWVSVEAFPERPSEYQFIHPVGAILVGYGGSKFGDIEQLGR
IAQQRDVRLMLTVFGSSLNADDGTLAILDETRLAMVGFAPPNCRPCHLISEEFLAEDAGA
WQYQLVLQTETQQVEVCREEKRPLFVAARYRRTDQDLNSDLKPKK
Download sequence
Identical sequences C6S6U4
WP_015815532.1.82858 662598.NMO_0928 gi|254804906|ref|YP_003083127.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]