SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229579628|ref|YP_002838027.1| from Sulfolobus islandicus Y.G.57.14

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229579628|ref|YP_002838027.1|
Domain Number 1 Region: 58-129
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000077
Family GHMP Kinase, N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229579628|ref|YP_002838027.1|
Sequence length 292
Comment beta-ribofuranosylaminobenzene 5'-phosphate synthase [Sulfolobus islandicus Y.G.57.14]
Sequence
MIKIIGLSRIHITLFDLEGKYGRIDGGVGVALKYPRIVVRSGNCFKPEVSLPFEVPKMCI
EEDFEEHIGLGHTTQYLLSVAKLSAEYNFKRLSSYELAKLVKRGGTSGVGVYAFDYGGFI
VDGGHSTKVKRELLPSDFSSAPPPPLIARLNFPWYIYVNVLKGGRRIFGKDEIKAFKEAK
LEGLDTLARVVLMELIPSVAEKDLEGTLDAISLIQNLGFKKVEVSLQADEVKKLMNGMAK
IGFPAGLSSFGPAVYTFVSSKREGEELISRFDGFISEPNNEGAKVFWSTINS
Download sequence
Identical sequences C3N7B1
WP_012716382.1.13477 439386.YG5714_1849 gi|229579628|ref|YP_002838027.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]