SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|253774236|ref|YP_003037067.1| from Escherichia coli 'BL21-Gold(DE3)pLysS AG'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253774236|ref|YP_003037067.1|
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily Phage tail protein-like 2.78e-49
Family Lambda phage gpU-like 0.000000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|253774236|ref|YP_003037067.1|
Sequence length 131
Comment minor tail U [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
Sequence
MKHTELRAAVLDALEKHDTGATFFDGRPAVFDEADFPAVAVYLTGAEYTGEELDSDTWQA
ELHIEVFLPAQVPDSELDAWMESRIYPVMSDIPALSDLITSMVASGYDYRRDDDAGLWSS
ADLTYVITYEM
Download sequence
Identical sequences A0A021X5X1 A0A023YTW2 A0A025BS11 A0A026UIE9 A0A066R5N2 A0A083ZYS7 A0A0B8XMB4 A0A0D1QUY7 A0A0F6C321 A0A0F6F533 A0A0H3PPL9 A0A0K2FIF4 A0A0K9T9Y9 A0A125X454 A0A140N9Z9 A0A142H0W8 A0A163VNK0 A0A1C0UQK9 A0A1E2Z8K6 A0A1Q5D826 A0A1S1V476 A0A1S6TE15 A0A1X3J706 A0A1X3LUB1 A0A1X8W3N0 A0A1Z3V3B1 A0A2A2XK45 A0A2G1VM41 A0A2H6KNC4 B6I1H5 C6ZCY6 C8U2Q6 D3GSJ4 D6HTA4 D8EEY7 E0IX26 E1JG49 E6BTU0 E9TIR3 F4TBB1 I2RTB6 I2WRY8 K7P895 K7PL32 L3PE12 L3QDG6 P03732 Q8X5E5 T5Z5S3 V0YS29 V5BJI3 V6FTM5 W1X2U1
1z1zA C6ZCY6_LAMBD VMTU_LAMBD gi|209917794|ref|YP_002291878.1| gi|209919248|ref|YP_002293332.1| gi|378713032|ref|YP_005277925.1| gi|544390198|ref|YP_008564709.1| gi|209398613|ref|YP_002270083.1| gi|386709389|ref|YP_006173110.1| gi|387607143|ref|YP_006095999.1| gi|254792624|ref|YP_003077461.1| gi|260842770|ref|YP_003220548.1| gi|251784277|ref|YP_002998581.1| gi|238903128|ref|YP_002928924.1| gi|428782023|ref|YP_007111786.1| gi|428782799|ref|YP_007112550.1| gi|9626255|ref|NP_040591.1| gi|15830893|ref|NP_309666.1| gi|387882135|ref|YP_006312437.1| gi|15801360|ref|NP_287377.1| 1z1z_A 000364047|e3fzbE1|304.124.1.4|E:4-134 000364050|e3fzbH1|304.124.1.4|H:4-134 000364051|e3fzbI1|304.124.1.4|I:4-134 d3fzba1 d3fzbb1 d3fzbc1 d3fzbd1 d3fzbe_ d3fzbf1 d3fzbg1 d3fzbh_ d3fzbi_ d3fzbj1 gi|387505599|ref|YP_006157855.1| 2001350161 gi|386709389|ref|YP_006173110.1| gi|378713032|ref|YP_005277925.1| gi|251784277|ref|YP_002998581.1| gi|253774236|ref|YP_003037067.1| NP_040591.1.28658 NP_309666.1.58667 WP_000683105.1.10001 WP_000683105.1.100073 WP_000683105.1.100085 WP_000683105.1.10010 WP_000683105.1.100185 WP_000683105.1.100252 WP_000683105.1.100283 WP_000683105.1.100299 WP_000683105.1.100302 WP_000683105.1.100441 WP_000683105.1.100508 WP_000683105.1.10051 WP_000683105.1.100554 WP_000683105.1.100569 WP_000683105.1.100571 WP_000683105.1.100688 WP_000683105.1.100752 WP_000683105.1.100778 WP_000683105.1.100851 WP_000683105.1.10086 WP_000683105.1.100867 WP_000683105.1.100990 WP_000683105.1.101102 WP_000683105.1.101105 WP_000683105.1.101166 WP_000683105.1.101206 WP_000683105.1.101257 WP_000683105.1.10126 WP_000683105.1.10131 WP_000683105.1.101430 WP_000683105.1.101439 WP_000683105.1.10154 WP_000683105.1.101628 WP_000683105.1.101654 WP_000683105.1.10190 WP_000683105.1.102036 WP_000683105.1.102094 WP_000683105.1.102139 WP_000683105.1.10273 WP_000683105.1.10335 WP_000683105.1.10381 WP_000683105.1.10400 WP_000683105.1.10476 WP_000683105.1.10524 WP_000683105.1.10628 WP_000683105.1.10651 WP_000683105.1.10705 WP_000683105.1.1073 WP_000683105.1.1074 WP_000683105.1.10748 WP_000683105.1.10761 WP_000683105.1.10824 WP_000683105.1.10862 WP_000683105.1.10940 WP_000683105.1.10970 WP_000683105.1.10989 WP_000683105.1.11052 WP_000683105.1.1111 WP_000683105.1.11121 WP_000683105.1.11133 WP_000683105.1.1122 WP_000683105.1.11240 WP_000683105.1.11301 WP_000683105.1.11420 WP_000683105.1.11542 WP_000683105.1.11671 WP_000683105.1.11690 WP_000683105.1.11748 WP_000683105.1.11803 WP_000683105.1.1186 WP_000683105.1.11955 WP_000683105.1.12230 WP_000683105.1.12259 WP_000683105.1.12279 WP_000683105.1.12305 WP_000683105.1.12319 WP_000683105.1.12320 WP_000683105.1.12342 WP_000683105.1.12352 WP_000683105.1.12458 WP_000683105.1.12478 WP_000683105.1.12552 WP_000683105.1.12582 WP_000683105.1.12693 WP_000683105.1.12717 WP_000683105.1.1275 WP_000683105.1.12766 WP_000683105.1.12917 WP_000683105.1.12979 WP_000683105.1.13002 WP_000683105.1.13015 WP_000683105.1.13031 WP_000683105.1.1308 WP_000683105.1.1315 WP_000683105.1.13217 WP_000683105.1.13223 WP_000683105.1.13239 WP_000683105.1.13271 WP_000683105.1.13301 WP_000683105.1.13332 WP_000683105.1.13333 WP_000683105.1.13348 WP_000683105.1.13409 WP_000683105.1.13430 WP_000683105.1.13437 WP_000683105.1.1345 WP_000683105.1.13481 WP_000683105.1.13492 WP_000683105.1.13495 WP_000683105.1.13525 WP_000683105.1.13662 WP_000683105.1.13881 WP_000683105.1.13936 WP_000683105.1.13944 WP_000683105.1.14110 WP_000683105.1.14322 WP_000683105.1.1439 WP_000683105.1.14417 WP_000683105.1.14432 WP_000683105.1.14453 WP_000683105.1.14506 WP_000683105.1.14582 WP_000683105.1.1461 WP_000683105.1.14621 WP_000683105.1.14672 WP_000683105.1.14678 WP_000683105.1.14746 WP_000683105.1.14748 WP_000683105.1.14871 WP_000683105.1.14946 WP_000683105.1.14993 WP_000683105.1.15087 WP_000683105.1.15282 WP_000683105.1.15300 WP_000683105.1.15347 WP_000683105.1.15356 WP_000683105.1.15377 WP_000683105.1.15453 WP_000683105.1.15503 WP_000683105.1.15521 WP_000683105.1.15523 WP_000683105.1.15527 WP_000683105.1.1559 WP_000683105.1.15626 WP_000683105.1.15645 WP_000683105.1.15702 WP_000683105.1.15747 WP_000683105.1.15752 WP_000683105.1.15767 WP_000683105.1.15782 WP_000683105.1.15855 WP_000683105.1.15906 WP_000683105.1.15945 WP_000683105.1.15983 WP_000683105.1.16010 WP_000683105.1.16034 WP_000683105.1.16075 WP_000683105.1.16133 WP_000683105.1.16154 WP_000683105.1.16188 WP_000683105.1.1621 WP_000683105.1.16222 WP_000683105.1.16272 WP_000683105.1.16388 WP_000683105.1.16481 WP_000683105.1.16532 WP_000683105.1.16541 WP_000683105.1.16592 WP_000683105.1.16612 WP_000683105.1.16648 WP_000683105.1.16682 WP_000683105.1.16715 WP_000683105.1.16766 WP_000683105.1.16780 WP_000683105.1.16805 WP_000683105.1.16843 WP_000683105.1.1710 WP_000683105.1.17102 WP_000683105.1.17111 WP_000683105.1.17182 WP_000683105.1.17187 WP_000683105.1.17205 WP_000683105.1.17267 WP_000683105.1.17333 WP_000683105.1.17373 WP_000683105.1.17386 WP_000683105.1.17415 WP_000683105.1.17417 WP_000683105.1.17515 WP_000683105.1.1754 WP_000683105.1.17577 WP_000683105.1.17595 WP_000683105.1.17765 WP_000683105.1.17769 WP_000683105.1.17829 WP_000683105.1.17831 WP_000683105.1.17889 WP_000683105.1.17904 WP_000683105.1.17920 WP_000683105.1.18000 WP_000683105.1.18006 WP_000683105.1.18064 WP_000683105.1.18112 WP_000683105.1.18118 WP_000683105.1.18136 WP_000683105.1.18326 WP_000683105.1.1834 WP_000683105.1.18383 WP_000683105.1.1844 WP_000683105.1.18461 WP_000683105.1.18482 WP_000683105.1.18583 WP_000683105.1.1862 WP_000683105.1.18714 WP_000683105.1.188 WP_000683105.1.1881 WP_000683105.1.18837 WP_000683105.1.18858 WP_000683105.1.18899 WP_000683105.1.18914 WP_000683105.1.18995 WP_000683105.1.19039 WP_000683105.1.1906 WP_000683105.1.191 WP_000683105.1.19100 WP_000683105.1.19114 WP_000683105.1.19140 WP_000683105.1.1925 WP_000683105.1.19297 WP_000683105.1.19350 WP_000683105.1.19478 WP_000683105.1.19544 WP_000683105.1.19545 WP_000683105.1.19661 WP_000683105.1.19760 WP_000683105.1.19840 WP_000683105.1.19847 WP_000683105.1.19889 WP_000683105.1.19940 WP_000683105.1.2005 WP_000683105.1.20096 WP_000683105.1.20139 WP_000683105.1.20370 WP_000683105.1.20449 WP_000683105.1.20480 WP_000683105.1.20483 WP_000683105.1.20519 WP_000683105.1.20546 WP_000683105.1.20594 WP_000683105.1.20596 WP_000683105.1.2060 WP_000683105.1.20630 WP_000683105.1.20636 WP_000683105.1.20662 WP_000683105.1.20693 WP_000683105.1.20745 WP_000683105.1.20831 WP_000683105.1.20841 WP_000683105.1.20893 WP_000683105.1.2092 WP_000683105.1.20933 WP_000683105.1.20936 WP_000683105.1.20941 WP_000683105.1.20950 WP_000683105.1.20982 WP_000683105.1.20989 WP_000683105.1.2100 WP_000683105.1.21022 WP_000683105.1.21059 WP_000683105.1.21104 WP_000683105.1.21122 WP_000683105.1.21277 WP_000683105.1.21336 WP_000683105.1.21426 WP_000683105.1.21508 WP_000683105.1.21519 WP_000683105.1.21656 WP_000683105.1.21668 WP_000683105.1.21733 WP_000683105.1.21756 WP_000683105.1.21812 WP_000683105.1.21824 WP_000683105.1.21909 WP_000683105.1.21948 WP_000683105.1.21962 WP_000683105.1.2218 WP_000683105.1.22182 WP_000683105.1.22195 WP_000683105.1.22251 WP_000683105.1.22304 WP_000683105.1.2232 WP_000683105.1.22350 WP_000683105.1.22381 WP_000683105.1.22497 WP_000683105.1.22508 WP_000683105.1.22594 WP_000683105.1.22631 WP_000683105.1.22777 WP_000683105.1.22809 WP_000683105.1.22925 WP_000683105.1.22988 WP_000683105.1.23073 WP_000683105.1.23090 WP_000683105.1.23105 WP_000683105.1.23135 WP_000683105.1.23270 WP_000683105.1.23290 WP_000683105.1.23323 WP_000683105.1.23467 WP_000683105.1.23486 WP_000683105.1.2353 WP_000683105.1.23640 WP_000683105.1.23746 WP_000683105.1.23806 WP_000683105.1.23838 WP_000683105.1.23869 WP_000683105.1.2388 WP_000683105.1.23895 WP_000683105.1.23899 WP_000683105.1.23945 WP_000683105.1.23950 WP_000683105.1.23973 WP_000683105.1.23984 WP_000683105.1.24 WP_000683105.1.24070 WP_000683105.1.24233 WP_000683105.1.2428 WP_000683105.1.24283 WP_000683105.1.24290 WP_000683105.1.24341 WP_000683105.1.24381 WP_000683105.1.24383 WP_000683105.1.24458 WP_000683105.1.24473 WP_000683105.1.24485 WP_000683105.1.24533 WP_000683105.1.24650 WP_000683105.1.24695 WP_000683105.1.24753 WP_000683105.1.24870 WP_000683105.1.24909 WP_000683105.1.24960 WP_000683105.1.24968 WP_000683105.1.25076 WP_000683105.1.25082 WP_000683105.1.25088 WP_000683105.1.25201 WP_000683105.1.25203 WP_000683105.1.25204 WP_000683105.1.25305 WP_000683105.1.25312 WP_000683105.1.25372 WP_000683105.1.25414 WP_000683105.1.2543 WP_000683105.1.25526 WP_000683105.1.25548 WP_000683105.1.25577 WP_000683105.1.25631 WP_000683105.1.25681 WP_000683105.1.25819 WP_000683105.1.25831 WP_000683105.1.26066 WP_000683105.1.26076 WP_000683105.1.26105 WP_000683105.1.26121 WP_000683105.1.26130 WP_000683105.1.26134 WP_000683105.1.26196 WP_000683105.1.26246 WP_000683105.1.26325 WP_000683105.1.2637 WP_000683105.1.26403 WP_000683105.1.26474 WP_000683105.1.26479 WP_000683105.1.26525 WP_000683105.1.26590 WP_000683105.1.26598 WP_000683105.1.26609 WP_000683105.1.26658 WP_000683105.1.26716 WP_000683105.1.26761 WP_000683105.1.26766 WP_000683105.1.26878 WP_000683105.1.26912 WP_000683105.1.26950 WP_000683105.1.26975 WP_000683105.1.26998 WP_000683105.1.27141 WP_000683105.1.27175 WP_000683105.1.27234 WP_000683105.1.27330 WP_000683105.1.27338 WP_000683105.1.27401 WP_000683105.1.27445 WP_000683105.1.27580 WP_000683105.1.27691 WP_000683105.1.27846 WP_000683105.1.27876 WP_000683105.1.27923 WP_000683105.1.28027 WP_000683105.1.28143 WP_000683105.1.28145 WP_000683105.1.28184 WP_000683105.1.2823 WP_000683105.1.28314 WP_000683105.1.28318 WP_000683105.1.28480 WP_000683105.1.28508 WP_000683105.1.28540 WP_000683105.1.28551 WP_000683105.1.28662 WP_000683105.1.28734 WP_000683105.1.2881 WP_000683105.1.28879 WP_000683105.1.28953 WP_000683105.1.290 WP_000683105.1.29001 WP_000683105.1.29026 WP_000683105.1.29055 WP_000683105.1.291 WP_000683105.1.29126 WP_000683105.1.29146 WP_000683105.1.29150 WP_000683105.1.29206 WP_000683105.1.29221 WP_000683105.1.29443 WP_000683105.1.29486 WP_000683105.1.29497 WP_000683105.1.29503 WP_000683105.1.2954 WP_000683105.1.29564 WP_000683105.1.29590 WP_000683105.1.29597 WP_000683105.1.29618 WP_000683105.1.29715 WP_000683105.1.2978 WP_000683105.1.29812 WP_000683105.1.29818 WP_000683105.1.29840 WP_000683105.1.29976 WP_000683105.1.30 WP_000683105.1.30019 WP_000683105.1.30052 WP_000683105.1.30064 WP_000683105.1.30105 WP_000683105.1.30164 WP_000683105.1.30397 WP_000683105.1.30476 WP_000683105.1.306 WP_000683105.1.30637 WP_000683105.1.30639 WP_000683105.1.30906 WP_000683105.1.30918 WP_000683105.1.30993 WP_000683105.1.30999 WP_000683105.1.31000 WP_000683105.1.31029 WP_000683105.1.31055 WP_000683105.1.312 WP_000683105.1.31252 WP_000683105.1.31295 WP_000683105.1.31379 WP_000683105.1.3140 WP_000683105.1.31401 WP_000683105.1.31422 WP_000683105.1.31431 WP_000683105.1.31433 WP_000683105.1.31506 WP_000683105.1.31575 WP_000683105.1.31715 WP_000683105.1.31740 WP_000683105.1.31803 WP_000683105.1.31835 WP_000683105.1.31860 WP_000683105.1.31937 WP_000683105.1.31956 WP_000683105.1.31978 WP_000683105.1.32020 WP_000683105.1.32063 WP_000683105.1.32091 WP_000683105.1.32121 WP_000683105.1.3215 WP_000683105.1.32184 WP_000683105.1.32236 WP_000683105.1.32243 WP_000683105.1.3233 WP_000683105.1.32356 WP_000683105.1.32406 WP_000683105.1.32448 WP_000683105.1.3248 WP_000683105.1.32509 WP_000683105.1.32536 WP_000683105.1.32574 WP_000683105.1.32590 WP_000683105.1.32591 WP_000683105.1.32888 WP_000683105.1.32931 WP_000683105.1.3295 WP_000683105.1.32984 WP_000683105.1.33014 WP_000683105.1.33049 WP_000683105.1.33055 WP_000683105.1.33061 WP_000683105.1.33094 WP_000683105.1.33125 WP_000683105.1.33146 WP_000683105.1.33167 WP_000683105.1.33178 WP_000683105.1.33424 WP_000683105.1.33475 WP_000683105.1.33595 WP_000683105.1.33638 WP_000683105.1.33667 WP_000683105.1.33745 WP_000683105.1.33746 WP_000683105.1.33854 WP_000683105.1.33948 WP_000683105.1.3398 WP_000683105.1.33981 WP_000683105.1.34122 WP_000683105.1.34204 WP_000683105.1.34206 WP_000683105.1.34224 WP_000683105.1.34269 WP_000683105.1.34383 WP_000683105.1.34397 WP_000683105.1.34440 WP_000683105.1.34470 WP_000683105.1.34500 WP_000683105.1.34605 WP_000683105.1.34655 WP_000683105.1.34680 WP_000683105.1.34686 WP_000683105.1.3472 WP_000683105.1.34763 WP_000683105.1.34993 WP_000683105.1.35006 WP_000683105.1.3515 WP_000683105.1.3539 WP_000683105.1.35464 WP_000683105.1.35468 WP_000683105.1.35604 WP_000683105.1.35934 WP_000683105.1.35942 WP_000683105.1.35990 WP_000683105.1.3600 WP_000683105.1.36010 WP_000683105.1.36094 WP_000683105.1.36212 WP_000683105.1.36412 WP_000683105.1.36500 WP_000683105.1.36626 WP_000683105.1.36724 WP_000683105.1.36739 WP_000683105.1.36856 WP_000683105.1.37099 WP_000683105.1.37102 WP_000683105.1.37206 WP_000683105.1.37312 WP_000683105.1.37334 WP_000683105.1.37472 WP_000683105.1.37485 WP_000683105.1.37548 WP_000683105.1.37554 WP_000683105.1.37588 WP_000683105.1.3762 WP_000683105.1.37731 WP_000683105.1.37758 WP_000683105.1.37766 WP_000683105.1.37769 WP_000683105.1.37852 WP_000683105.1.37858 WP_000683105.1.3788 WP_000683105.1.37880 WP_000683105.1.37918 WP_000683105.1.37923 WP_000683105.1.3795 WP_000683105.1.3796 WP_000683105.1.38050 WP_000683105.1.38063 WP_000683105.1.38081 WP_000683105.1.38105 WP_000683105.1.38107 WP_000683105.1.38306 WP_000683105.1.38314 WP_000683105.1.38323 WP_000683105.1.38369 WP_000683105.1.38371 WP_000683105.1.3873 WP_000683105.1.38751 WP_000683105.1.38770 WP_000683105.1.38835 WP_000683105.1.389 WP_000683105.1.38920 WP_000683105.1.38937 WP_000683105.1.38956 WP_000683105.1.38958 WP_000683105.1.39037 WP_000683105.1.39164 WP_000683105.1.39180 WP_000683105.1.39216 WP_000683105.1.3922 WP_000683105.1.39268 WP_000683105.1.39302 WP_000683105.1.39305 WP_000683105.1.39310 WP_000683105.1.39313 WP_000683105.1.39415 WP_000683105.1.39481 WP_000683105.1.39492 WP_000683105.1.39509 WP_000683105.1.39541 WP_000683105.1.39564 WP_000683105.1.39580 WP_000683105.1.39601 WP_000683105.1.39606 WP_000683105.1.39607 WP_000683105.1.39610 WP_000683105.1.39646 WP_000683105.1.39780 WP_000683105.1.39820 WP_000683105.1.39973 WP_000683105.1.40 WP_000683105.1.40113 WP_000683105.1.40147 WP_000683105.1.40159 WP_000683105.1.40234 WP_000683105.1.40238 WP_000683105.1.4030 WP_000683105.1.40315 WP_000683105.1.40317 WP_000683105.1.40335 WP_000683105.1.40389 WP_000683105.1.40499 WP_000683105.1.40549 WP_000683105.1.40596 WP_000683105.1.40629 WP_000683105.1.40742 WP_000683105.1.40758 WP_000683105.1.40781 WP_000683105.1.40793 WP_000683105.1.40815 WP_000683105.1.40865 WP_000683105.1.40882 WP_000683105.1.40900 WP_000683105.1.40952 WP_000683105.1.4103 WP_000683105.1.41037 WP_000683105.1.41287 WP_000683105.1.41294 WP_000683105.1.41315 WP_000683105.1.41330 WP_000683105.1.41371 WP_000683105.1.41394 WP_000683105.1.41407 WP_000683105.1.41417 WP_000683105.1.41478 WP_000683105.1.41530 WP_000683105.1.41536 WP_000683105.1.41566 WP_000683105.1.41712 WP_000683105.1.4172 WP_000683105.1.41734 WP_000683105.1.41740 WP_000683105.1.41780 WP_000683105.1.41809 WP_000683105.1.41849 WP_000683105.1.4193 WP_000683105.1.41988 WP_000683105.1.41991 WP_000683105.1.42036 WP_000683105.1.42044 WP_000683105.1.42060 WP_000683105.1.4213 WP_000683105.1.42151 WP_000683105.1.42159 WP_000683105.1.42221 WP_000683105.1.4224 WP_000683105.1.42258 WP_000683105.1.42369 WP_000683105.1.42447 WP_000683105.1.42480 WP_000683105.1.42513 WP_000683105.1.42594 WP_000683105.1.4261 WP_000683105.1.42669 WP_000683105.1.42749 WP_000683105.1.4282 WP_000683105.1.42863 WP_000683105.1.42891 WP_000683105.1.42975 WP_000683105.1.43013 WP_000683105.1.43079 WP_000683105.1.43121 WP_000683105.1.4313 WP_000683105.1.43132 WP_000683105.1.43140 WP_000683105.1.43166 WP_000683105.1.43196 WP_000683105.1.4334 WP_000683105.1.43384 WP_000683105.1.43444 WP_000683105.1.43448 WP_000683105.1.43455 WP_000683105.1.43536 WP_000683105.1.43604 WP_000683105.1.43720 WP_000683105.1.43738 WP_000683105.1.43750 WP_000683105.1.43798 WP_000683105.1.43816 WP_000683105.1.43837 WP_000683105.1.43898 WP_000683105.1.43911 WP_000683105.1.43939 WP_000683105.1.44040 WP_000683105.1.44088 WP_000683105.1.44115 WP_000683105.1.44125 WP_000683105.1.44165 WP_000683105.1.44203 WP_000683105.1.44314 WP_000683105.1.44335 WP_000683105.1.44389 WP_000683105.1.44422 WP_000683105.1.44445 WP_000683105.1.44488 WP_000683105.1.44524 WP_000683105.1.44539 WP_000683105.1.44561 WP_000683105.1.44601 WP_000683105.1.44649 WP_000683105.1.44661 WP_000683105.1.44668 WP_000683105.1.44706 WP_000683105.1.44724 WP_000683105.1.44733 WP_000683105.1.44756 WP_000683105.1.44800 WP_000683105.1.44854 WP_000683105.1.44872 WP_000683105.1.44906 WP_000683105.1.44954 WP_000683105.1.44961 WP_000683105.1.44975 WP_000683105.1.45020 WP_000683105.1.45053 WP_000683105.1.45116 WP_000683105.1.45153 WP_000683105.1.45195 WP_000683105.1.45293 WP_000683105.1.45444 WP_000683105.1.45486 WP_000683105.1.45575 WP_000683105.1.45600 WP_000683105.1.45664 WP_000683105.1.4570 WP_000683105.1.45707 WP_000683105.1.45841 WP_000683105.1.45865 WP_000683105.1.45901 WP_000683105.1.45930 WP_000683105.1.45941 WP_000683105.1.46027 WP_000683105.1.46039 WP_000683105.1.46048 WP_000683105.1.46049 WP_000683105.1.46070 WP_000683105.1.46115 WP_000683105.1.46122 WP_000683105.1.4613 WP_000683105.1.46158 WP_000683105.1.4619 WP_000683105.1.46282 WP_000683105.1.46283 WP_000683105.1.46301 WP_000683105.1.46369 WP_000683105.1.46414 WP_000683105.1.46451 WP_000683105.1.46477 WP_000683105.1.46503 WP_000683105.1.46526 WP_000683105.1.4656 WP_000683105.1.46589 WP_000683105.1.46597 WP_000683105.1.46611 WP_000683105.1.46614 WP_000683105.1.46626 WP_000683105.1.46655 WP_000683105.1.46821 WP_000683105.1.46832 WP_000683105.1.4691 WP_000683105.1.46913 WP_000683105.1.47028 WP_000683105.1.47038 WP_000683105.1.47048 WP_000683105.1.47069 WP_000683105.1.4708 WP_000683105.1.47140 WP_000683105.1.47197 WP_000683105.1.4723 WP_000683105.1.47246 WP_000683105.1.47247 WP_000683105.1.47280 WP_000683105.1.47356 WP_000683105.1.47370 WP_000683105.1.47398 WP_000683105.1.4740 WP_000683105.1.47411 WP_000683105.1.47464 WP_000683105.1.47546 WP_000683105.1.47599 WP_000683105.1.47634 WP_000683105.1.47722 WP_000683105.1.47734 WP_000683105.1.47827 WP_000683105.1.4785 WP_000683105.1.47884 WP_000683105.1.47954 WP_000683105.1.47976 WP_000683105.1.47994 WP_000683105.1.48018 WP_000683105.1.48029 WP_000683105.1.48065 WP_000683105.1.4812 WP_000683105.1.48176 WP_000683105.1.48216 WP_000683105.1.48226 WP_000683105.1.48229 WP_000683105.1.48258 WP_000683105.1.48353 WP_000683105.1.48615 WP_000683105.1.48678 WP_000683105.1.48686 WP_000683105.1.48697 WP_000683105.1.48712 WP_000683105.1.48792 WP_000683105.1.48806 WP_000683105.1.48847 WP_000683105.1.48921 WP_000683105.1.49190 WP_000683105.1.49243 WP_000683105.1.49275 WP_000683105.1.4931 WP_000683105.1.49312 WP_000683105.1.49332 WP_000683105.1.49401 WP_000683105.1.49431 WP_000683105.1.49459 WP_000683105.1.49464 WP_000683105.1.49481 WP_000683105.1.4949 WP_000683105.1.49496 WP_000683105.1.49546 WP_000683105.1.49655 WP_000683105.1.49768 WP_000683105.1.49771 WP_000683105.1.49987 WP_000683105.1.5003 WP_000683105.1.50078 WP_000683105.1.50110 WP_000683105.1.50113 WP_000683105.1.50207 WP_000683105.1.50329 WP_000683105.1.50345 WP_000683105.1.50358 WP_000683105.1.5037 WP_000683105.1.50446 WP_000683105.1.50549 WP_000683105.1.50564 WP_000683105.1.50586 WP_000683105.1.50715 WP_000683105.1.50725 WP_000683105.1.50728 WP_000683105.1.50762 WP_000683105.1.50986 WP_000683105.1.51027 WP_000683105.1.51154 WP_000683105.1.51172 WP_000683105.1.51405 WP_000683105.1.51427 WP_000683105.1.51462 WP_000683105.1.51490 WP_000683105.1.51505 WP_000683105.1.51552 WP_000683105.1.5158 WP_000683105.1.51580 WP_000683105.1.51629 WP_000683105.1.51693 WP_000683105.1.51707 WP_000683105.1.51834 WP_000683105.1.51837 WP_000683105.1.51873 WP_000683105.1.51949 WP_000683105.1.51985 WP_000683105.1.51988 WP_000683105.1.5199 WP_000683105.1.52039 WP_000683105.1.52076 WP_000683105.1.52127 WP_000683105.1.52137 WP_000683105.1.5217 WP_000683105.1.52186 WP_000683105.1.52200 WP_000683105.1.52333 WP_000683105.1.52419 WP_000683105.1.52496 WP_000683105.1.52543 WP_000683105.1.52662 WP_000683105.1.5277 WP_000683105.1.52801 WP_000683105.1.52883 WP_000683105.1.52933 WP_000683105.1.52945 WP_000683105.1.52962 WP_000683105.1.53084 WP_000683105.1.53110 WP_000683105.1.53181 WP_000683105.1.53242 WP_000683105.1.53252 WP_000683105.1.53262 WP_000683105.1.53270 WP_000683105.1.53360 WP_000683105.1.53431 WP_000683105.1.53582 WP_000683105.1.5362 WP_000683105.1.53642 WP_000683105.1.53769 WP_000683105.1.53972 WP_000683105.1.54024 WP_000683105.1.54028 WP_000683105.1.54072 WP_000683105.1.54185 WP_000683105.1.54213 WP_000683105.1.54317 WP_000683105.1.5441 WP_000683105.1.54417 WP_000683105.1.54546 WP_000683105.1.5460 WP_000683105.1.54602 WP_000683105.1.54638 WP_000683105.1.54641 WP_000683105.1.54643 WP_000683105.1.5467 WP_000683105.1.54695 WP_000683105.1.54708 WP_000683105.1.5479 WP_000683105.1.54798 WP_000683105.1.54829 WP_000683105.1.54883 WP_000683105.1.54918 WP_000683105.1.54972 WP_000683105.1.55144 WP_000683105.1.55151 WP_000683105.1.55197 WP_000683105.1.55218 WP_000683105.1.55286 WP_000683105.1.55359 WP_000683105.1.55571 WP_000683105.1.55629 WP_000683105.1.5570 WP_000683105.1.55709 WP_000683105.1.55720 WP_000683105.1.55820 WP_000683105.1.55838 WP_000683105.1.55892 WP_000683105.1.55897 WP_000683105.1.55995 WP_000683105.1.56072 WP_000683105.1.56151 WP_000683105.1.56169 WP_000683105.1.562 WP_000683105.1.56216 WP_000683105.1.5639 WP_000683105.1.56399 WP_000683105.1.56439 WP_000683105.1.56481 WP_000683105.1.56489 WP_000683105.1.56491 WP_000683105.1.56513 WP_000683105.1.56554 WP_000683105.1.56571 WP_000683105.1.56704 WP_000683105.1.56721 WP_000683105.1.56799 WP_000683105.1.5685 WP_000683105.1.56885 WP_000683105.1.57032 WP_000683105.1.57068 WP_000683105.1.57071 WP_000683105.1.57100 WP_000683105.1.57180 WP_000683105.1.57197 WP_000683105.1.57386 WP_000683105.1.57438 WP_000683105.1.57453 WP_000683105.1.57466 WP_000683105.1.5748 WP_000683105.1.57487 WP_000683105.1.5755 WP_000683105.1.57610 WP_000683105.1.57638 WP_000683105.1.5764 WP_000683105.1.57646 WP_000683105.1.57836 WP_000683105.1.57846 WP_000683105.1.57903 WP_000683105.1.57920 WP_000683105.1.58038 WP_000683105.1.58048 WP_000683105.1.58057 WP_000683105.1.5812 WP_000683105.1.58146 WP_000683105.1.58169 WP_000683105.1.58232 WP_000683105.1.58238 WP_000683105.1.58244 WP_000683105.1.58248 WP_000683105.1.58267 WP_000683105.1.58289 WP_000683105.1.584 WP_000683105.1.58440 WP_000683105.1.58444 WP_000683105.1.58445 WP_000683105.1.58493 WP_000683105.1.58514 WP_000683105.1.5852 WP_000683105.1.58547 WP_000683105.1.58572 WP_000683105.1.58707 WP_000683105.1.58723 WP_000683105.1.59038 WP_000683105.1.5906 WP_000683105.1.59199 WP_000683105.1.59280 WP_000683105.1.59302 WP_000683105.1.59306 WP_000683105.1.59374 WP_000683105.1.59407 WP_000683105.1.59434 WP_000683105.1.59470 WP_000683105.1.59491 WP_000683105.1.59599 WP_000683105.1.59615 WP_000683105.1.5963 WP_000683105.1.59638 WP_000683105.1.5965 WP_000683105.1.59679 WP_000683105.1.59733 WP_000683105.1.59756 WP_000683105.1.59838 WP_000683105.1.59858 WP_000683105.1.59905 WP_000683105.1.59914 WP_000683105.1.59931 WP_000683105.1.59959 WP_000683105.1.60023 WP_000683105.1.60042 WP_000683105.1.60043 WP_000683105.1.60117 WP_000683105.1.6013 WP_000683105.1.6022 WP_000683105.1.60304 WP_000683105.1.60374 WP_000683105.1.60411 WP_000683105.1.60461 WP_000683105.1.60550 WP_000683105.1.60570 WP_000683105.1.60613 WP_000683105.1.6064 WP_000683105.1.60647 WP_000683105.1.60698 WP_000683105.1.60732 WP_000683105.1.60744 WP_000683105.1.60761 WP_000683105.1.60872 WP_000683105.1.6088 WP_000683105.1.60921 WP_000683105.1.6095 WP_000683105.1.60973 WP_000683105.1.61039 WP_000683105.1.61046 WP_000683105.1.61097 WP_000683105.1.61099 WP_000683105.1.61108 WP_000683105.1.61174 WP_000683105.1.61175 WP_000683105.1.61186 WP_000683105.1.61225 WP_000683105.1.61253 WP_000683105.1.61524 WP_000683105.1.61551 WP_000683105.1.61617 WP_000683105.1.61623 WP_000683105.1.61758 WP_000683105.1.61772 WP_000683105.1.61774 WP_000683105.1.618 WP_000683105.1.61874 WP_000683105.1.62041 WP_000683105.1.62102 WP_000683105.1.62135 WP_000683105.1.62182 WP_000683105.1.62264 WP_000683105.1.62290 WP_000683105.1.62296 WP_000683105.1.62322 WP_000683105.1.62358 WP_000683105.1.62460 WP_000683105.1.62480 WP_000683105.1.62518 WP_000683105.1.6261 WP_000683105.1.62612 WP_000683105.1.62675 WP_000683105.1.62750 WP_000683105.1.62802 WP_000683105.1.62843 WP_000683105.1.62888 WP_000683105.1.6331 WP_000683105.1.63445 WP_000683105.1.63470 WP_000683105.1.63478 WP_000683105.1.6348 WP_000683105.1.63563 WP_000683105.1.63576 WP_000683105.1.63586 WP_000683105.1.63615 WP_000683105.1.6364 WP_000683105.1.63746 WP_000683105.1.63810 WP_000683105.1.63856 WP_000683105.1.63872 WP_000683105.1.63957 WP_000683105.1.64086 WP_000683105.1.64150 WP_000683105.1.64161 WP_000683105.1.64193 WP_000683105.1.64195 WP_000683105.1.64355 WP_000683105.1.64371 WP_000683105.1.64380 WP_000683105.1.6441 WP_000683105.1.64437 WP_000683105.1.6445 WP_000683105.1.64458 WP_000683105.1.6446 WP_000683105.1.64520 WP_000683105.1.64528 WP_000683105.1.64572 WP_000683105.1.64621 WP_000683105.1.64634 WP_000683105.1.6469 WP_000683105.1.6485 WP_000683105.1.64946 WP_000683105.1.64990 WP_000683105.1.65023 WP_000683105.1.65035 WP_000683105.1.65084 WP_000683105.1.6511 WP_000683105.1.65151 WP_000683105.1.65155 WP_000683105.1.65194 WP_000683105.1.65256 WP_000683105.1.65271 WP_000683105.1.65305 WP_000683105.1.65306 WP_000683105.1.65353 WP_000683105.1.65366 WP_000683105.1.65372 WP_000683105.1.65413 WP_000683105.1.65493 WP_000683105.1.65546 WP_000683105.1.65571 WP_000683105.1.6587 WP_000683105.1.65875 WP_000683105.1.65898 WP_000683105.1.65963 WP_000683105.1.65978 WP_000683105.1.65982 WP_000683105.1.65988 WP_000683105.1.65991 WP_000683105.1.66007 WP_000683105.1.66033 WP_000683105.1.66100 WP_000683105.1.66280 WP_000683105.1.66412 WP_000683105.1.66531 WP_000683105.1.66566 WP_000683105.1.6665 WP_000683105.1.66795 WP_000683105.1.66873 WP_000683105.1.66922 WP_000683105.1.66948 WP_000683105.1.67021 WP_000683105.1.67073 WP_000683105.1.67136 WP_000683105.1.67150 WP_000683105.1.67200 WP_000683105.1.67415 WP_000683105.1.67446 WP_000683105.1.67451 WP_000683105.1.67454 WP_000683105.1.67468 WP_000683105.1.67522 WP_000683105.1.67533 WP_000683105.1.67553 WP_000683105.1.67581 WP_000683105.1.67676 WP_000683105.1.6769 WP_000683105.1.67701 WP_000683105.1.67724 WP_000683105.1.67726 WP_000683105.1.67753 WP_000683105.1.67775 WP_000683105.1.67780 WP_000683105.1.67786 WP_000683105.1.678 WP_000683105.1.67999 WP_000683105.1.68025 WP_000683105.1.68071 WP_000683105.1.68096 WP_000683105.1.68108 WP_000683105.1.68241 WP_000683105.1.68255 WP_000683105.1.68278 WP_000683105.1.68411 WP_000683105.1.68482 WP_000683105.1.68493 WP_000683105.1.68523 WP_000683105.1.68673 WP_000683105.1.68678 WP_000683105.1.68701 WP_000683105.1.68751 WP_000683105.1.68936 WP_000683105.1.68956 WP_000683105.1.69054 WP_000683105.1.69098 WP_000683105.1.6916 WP_000683105.1.69160 WP_000683105.1.69221 WP_000683105.1.69258 WP_000683105.1.69350 WP_000683105.1.69351 WP_000683105.1.69450 WP_000683105.1.69472 WP_000683105.1.69646 WP_000683105.1.69655 WP_000683105.1.69765 WP_000683105.1.69780 WP_000683105.1.69803 WP_000683105.1.69810 WP_000683105.1.69818 WP_000683105.1.69896 WP_000683105.1.70101 WP_000683105.1.70123 WP_000683105.1.70125 WP_000683105.1.70230 WP_000683105.1.70256 WP_000683105.1.70477 WP_000683105.1.70490 WP_000683105.1.70517 WP_000683105.1.7052 WP_000683105.1.70539 WP_000683105.1.70576 WP_000683105.1.70582 WP_000683105.1.70592 WP_000683105.1.70723 WP_000683105.1.70745 WP_000683105.1.70767 WP_000683105.1.70787 WP_000683105.1.7090 WP_000683105.1.71003 WP_000683105.1.71042 WP_000683105.1.71099 WP_000683105.1.71109 WP_000683105.1.71162 WP_000683105.1.71170 WP_000683105.1.71205 WP_000683105.1.71225 WP_000683105.1.71226 WP_000683105.1.71269 WP_000683105.1.71273 WP_000683105.1.71315 WP_000683105.1.71339 WP_000683105.1.71354 WP_000683105.1.71397 WP_000683105.1.71423 WP_000683105.1.71448 WP_000683105.1.71522 WP_000683105.1.71533 WP_000683105.1.71537 WP_000683105.1.71632 WP_000683105.1.71783 WP_000683105.1.71840 WP_000683105.1.7192 WP_000683105.1.71940 WP_000683105.1.7205 WP_000683105.1.7210 WP_000683105.1.72125 WP_000683105.1.72180 WP_000683105.1.72237 WP_000683105.1.7225 WP_000683105.1.72322 WP_000683105.1.72391 WP_000683105.1.72427 WP_000683105.1.72608 WP_000683105.1.72614 WP_000683105.1.72619 WP_000683105.1.72641 WP_000683105.1.72694 WP_000683105.1.72725 WP_000683105.1.72729 WP_000683105.1.72745 WP_000683105.1.72751 WP_000683105.1.72758 WP_000683105.1.72857 WP_000683105.1.7291 WP_000683105.1.72913 WP_000683105.1.73010 WP_000683105.1.73072 WP_000683105.1.73126 WP_000683105.1.73249 WP_000683105.1.73257 WP_000683105.1.73259 WP_000683105.1.73343 WP_000683105.1.73349 WP_000683105.1.73393 WP_000683105.1.73428 WP_000683105.1.73468 WP_000683105.1.7349 WP_000683105.1.73604 WP_000683105.1.73626 WP_000683105.1.73631 WP_000683105.1.73785 WP_000683105.1.73801 WP_000683105.1.73811 WP_000683105.1.73833 WP_000683105.1.73846 WP_000683105.1.7392 WP_000683105.1.73934 WP_000683105.1.73968 WP_000683105.1.74046 WP_000683105.1.74051 WP_000683105.1.74185 WP_000683105.1.7425 WP_000683105.1.7429 WP_000683105.1.74365 WP_000683105.1.74430 WP_000683105.1.7446 WP_000683105.1.74501 WP_000683105.1.74521 WP_000683105.1.74536 WP_000683105.1.74557 WP_000683105.1.74624 WP_000683105.1.74652 WP_000683105.1.74670 WP_000683105.1.74687 WP_000683105.1.74691 WP_000683105.1.74705 WP_000683105.1.74828 WP_000683105.1.74844 WP_000683105.1.74854 WP_000683105.1.74904 WP_000683105.1.75030 WP_000683105.1.75112 WP_000683105.1.75139 WP_000683105.1.75164 WP_000683105.1.75243 WP_000683105.1.75248 WP_000683105.1.75254 WP_000683105.1.7536 WP_000683105.1.75360 WP_000683105.1.75382 WP_000683105.1.7539 WP_000683105.1.75465 WP_000683105.1.75507 WP_000683105.1.75536 WP_000683105.1.75577 WP_000683105.1.75602 WP_000683105.1.75612 WP_000683105.1.75629 WP_000683105.1.75679 WP_000683105.1.75694 WP_000683105.1.75758 WP_000683105.1.75767 WP_000683105.1.7583 WP_000683105.1.75918 WP_000683105.1.7597 WP_000683105.1.75989 WP_000683105.1.7603 WP_000683105.1.76036 WP_000683105.1.76054 WP_000683105.1.7608 WP_000683105.1.76103 WP_000683105.1.76119 WP_000683105.1.76152 WP_000683105.1.76184 WP_000683105.1.76211 WP_000683105.1.76384 WP_000683105.1.76407 WP_000683105.1.76448 WP_000683105.1.76477 WP_000683105.1.76557 WP_000683105.1.7661 WP_000683105.1.76697 WP_000683105.1.76827 WP_000683105.1.76831 WP_000683105.1.76884 WP_000683105.1.7699 WP_000683105.1.77070 WP_000683105.1.77099 WP_000683105.1.77128 WP_000683105.1.77173 WP_000683105.1.77255 WP_000683105.1.77258 WP_000683105.1.77275 WP_000683105.1.77341 WP_000683105.1.77358 WP_000683105.1.77392 WP_000683105.1.77419 WP_000683105.1.77437 WP_000683105.1.77495 WP_000683105.1.77503 WP_000683105.1.77540 WP_000683105.1.77542 WP_000683105.1.77551 WP_000683105.1.7756 WP_000683105.1.77581 WP_000683105.1.77636 WP_000683105.1.77644 WP_000683105.1.77760 WP_000683105.1.77785 WP_000683105.1.7781 WP_000683105.1.77929 WP_000683105.1.77949 WP_000683105.1.7795 WP_000683105.1.77950 WP_000683105.1.77961 WP_000683105.1.77979 WP_000683105.1.7799 WP_000683105.1.78059 WP_000683105.1.78063 WP_000683105.1.7808 WP_000683105.1.78089 WP_000683105.1.78101 WP_000683105.1.78196 WP_000683105.1.78297 WP_000683105.1.784 WP_000683105.1.78515 WP_000683105.1.7855 WP_000683105.1.78583 WP_000683105.1.78593 WP_000683105.1.78610 WP_000683105.1.78611 WP_000683105.1.78718 WP_000683105.1.7883 WP_000683105.1.78908 WP_000683105.1.78919 WP_000683105.1.78953 WP_000683105.1.7898 WP_000683105.1.79075 WP_000683105.1.79088 WP_000683105.1.79159 WP_000683105.1.79172 WP_000683105.1.79248 WP_000683105.1.79312 WP_000683105.1.79346 WP_000683105.1.79369 WP_000683105.1.7937 WP_000683105.1.79391 WP_000683105.1.79443 WP_000683105.1.79525 WP_000683105.1.79528 WP_000683105.1.79558 WP_000683105.1.79563 WP_000683105.1.79576 WP_000683105.1.79715 WP_000683105.1.79800 WP_000683105.1.79866 WP_000683105.1.79868 WP_000683105.1.79877 WP_000683105.1.79965 WP_000683105.1.80043 WP_000683105.1.80176 WP_000683105.1.80192 WP_000683105.1.80309 WP_000683105.1.80330 WP_000683105.1.80484 WP_000683105.1.80578 WP_000683105.1.80606 WP_000683105.1.80754 WP_000683105.1.80804 WP_000683105.1.80843 WP_000683105.1.80862 WP_000683105.1.80894 WP_000683105.1.8090 WP_000683105.1.80985 WP_000683105.1.81160 WP_000683105.1.81165 WP_000683105.1.8118 WP_000683105.1.81219 WP_000683105.1.81273 WP_000683105.1.81420 WP_000683105.1.81442 WP_000683105.1.81484 WP_000683105.1.81514 WP_000683105.1.81625 WP_000683105.1.81688 WP_000683105.1.81754 WP_000683105.1.81821 WP_000683105.1.81832 WP_000683105.1.81869 WP_000683105.1.81873 WP_000683105.1.81914 WP_000683105.1.81934 WP_000683105.1.82010 WP_000683105.1.82057 WP_000683105.1.82296 WP_000683105.1.8235 WP_000683105.1.82378 WP_000683105.1.82594 WP_000683105.1.82626 WP_000683105.1.82629 WP_000683105.1.82666 WP_000683105.1.8268 WP_000683105.1.82711 WP_000683105.1.82784 WP_000683105.1.82797 WP_000683105.1.82799 WP_000683105.1.82800 WP_000683105.1.82820 WP_000683105.1.82923 WP_000683105.1.8306 WP_000683105.1.83093 WP_000683105.1.83151 WP_000683105.1.83564 WP_000683105.1.83680 WP_000683105.1.83712 WP_000683105.1.84219 WP_000683105.1.84264 WP_000683105.1.84312 WP_000683105.1.84348 WP_000683105.1.84402 WP_000683105.1.84473 WP_000683105.1.84482 WP_000683105.1.84534 WP_000683105.1.84635 WP_000683105.1.84668 WP_000683105.1.84675 WP_000683105.1.8477 WP_000683105.1.84994 WP_000683105.1.85011 WP_000683105.1.85052 WP_000683105.1.85090 WP_000683105.1.85098 WP_000683105.1.85105 WP_000683105.1.85216 WP_000683105.1.85253 WP_000683105.1.85323 WP_000683105.1.85335 WP_000683105.1.85342 WP_000683105.1.85657 WP_000683105.1.85722 WP_000683105.1.85772 WP_000683105.1.85939 WP_000683105.1.8603 WP_000683105.1.8607 WP_000683105.1.86105 WP_000683105.1.86149 WP_000683105.1.86166 WP_000683105.1.86171 WP_000683105.1.86176 WP_000683105.1.8621 WP_000683105.1.86225 WP_000683105.1.86263 WP_000683105.1.86266 WP_000683105.1.86273 WP_000683105.1.86283 WP_000683105.1.86340 WP_000683105.1.86355 WP_000683105.1.86393 WP_000683105.1.86411 WP_000683105.1.86452 WP_000683105.1.86454 WP_000683105.1.86492 WP_000683105.1.86574 WP_000683105.1.86609 WP_000683105.1.86640 WP_000683105.1.86674 WP_000683105.1.86734 WP_000683105.1.86956 WP_000683105.1.86994 WP_000683105.1.87076 WP_000683105.1.87247 WP_000683105.1.87249 WP_000683105.1.87254 WP_000683105.1.87358 WP_000683105.1.87382 WP_000683105.1.87400 WP_000683105.1.87465 WP_000683105.1.87491 WP_000683105.1.87563 WP_000683105.1.87568 WP_000683105.1.87639 WP_000683105.1.87788 WP_000683105.1.88020 WP_000683105.1.88088 WP_000683105.1.88197 WP_000683105.1.88238 WP_000683105.1.88285 WP_000683105.1.88376 WP_000683105.1.88379 WP_000683105.1.88384 WP_000683105.1.8843 WP_000683105.1.88467 WP_000683105.1.88528 WP_000683105.1.88539 WP_000683105.1.88646 WP_000683105.1.88732 WP_000683105.1.88803 WP_000683105.1.88830 WP_000683105.1.88834 WP_000683105.1.88891 WP_000683105.1.88953 WP_000683105.1.89050 WP_000683105.1.8906 WP_000683105.1.89183 WP_000683105.1.89200 WP_000683105.1.89214 WP_000683105.1.89255 WP_000683105.1.8928 WP_000683105.1.89312 WP_000683105.1.89322 WP_000683105.1.89334 WP_000683105.1.89335 WP_000683105.1.894 WP_000683105.1.89405 WP_000683105.1.89432 WP_000683105.1.8945 WP_000683105.1.89474 WP_000683105.1.89492 WP_000683105.1.89569 WP_000683105.1.89700 WP_000683105.1.89781 WP_000683105.1.89788 WP_000683105.1.89920 WP_000683105.1.89959 WP_000683105.1.89988 WP_000683105.1.90115 WP_000683105.1.90139 WP_000683105.1.90219 WP_000683105.1.90257 WP_000683105.1.90342 WP_000683105.1.90349 WP_000683105.1.9036 WP_000683105.1.90405 WP_000683105.1.90435 WP_000683105.1.90441 WP_000683105.1.90536 WP_000683105.1.9059 WP_000683105.1.9061 WP_000683105.1.90690 WP_000683105.1.90703 WP_000683105.1.90758 WP_000683105.1.90799 WP_000683105.1.90828 WP_000683105.1.90837 WP_000683105.1.90848 WP_000683105.1.90897 WP_000683105.1.90967 WP_000683105.1.9098 WP_000683105.1.90997 WP_000683105.1.91072 WP_000683105.1.91088 WP_000683105.1.91121 WP_000683105.1.91153 WP_000683105.1.91268 WP_000683105.1.91277 WP_000683105.1.91341 WP_000683105.1.91356 WP_000683105.1.91384 WP_000683105.1.91414 WP_000683105.1.91445 WP_000683105.1.91548 WP_000683105.1.91596 WP_000683105.1.9160 WP_000683105.1.91643 WP_000683105.1.91644 WP_000683105.1.91651 WP_000683105.1.9168 WP_000683105.1.91685 WP_000683105.1.91787 WP_000683105.1.91801 WP_000683105.1.91843 WP_000683105.1.91871 WP_000683105.1.91879 WP_000683105.1.91954 WP_000683105.1.91965 WP_000683105.1.92005 WP_000683105.1.921 WP_000683105.1.92163 WP_000683105.1.92304 WP_000683105.1.92311 WP_000683105.1.92361 WP_000683105.1.92558 WP_000683105.1.92568 WP_000683105.1.92792 WP_000683105.1.92819 WP_000683105.1.93005 WP_000683105.1.93016 WP_000683105.1.93027 WP_000683105.1.93052 WP_000683105.1.93100 WP_000683105.1.93133 WP_000683105.1.93253 WP_000683105.1.93267 WP_000683105.1.93379 WP_000683105.1.93427 WP_000683105.1.93428 WP_000683105.1.93531 WP_000683105.1.93552 WP_000683105.1.93601 WP_000683105.1.93630 WP_000683105.1.93665 WP_000683105.1.93670 WP_000683105.1.93673 WP_000683105.1.93695 WP_000683105.1.93743 WP_000683105.1.93877 WP_000683105.1.93911 WP_000683105.1.93918 WP_000683105.1.93939 WP_000683105.1.94069 WP_000683105.1.94213 WP_000683105.1.9426 WP_000683105.1.94317 WP_000683105.1.94343 WP_000683105.1.94367 WP_000683105.1.94436 WP_000683105.1.94475 WP_000683105.1.94544 WP_000683105.1.94580 WP_000683105.1.94646 WP_000683105.1.94676 WP_000683105.1.94692 WP_000683105.1.94790 WP_000683105.1.948 WP_000683105.1.94836 WP_000683105.1.94877 WP_000683105.1.94912 WP_000683105.1.94955 WP_000683105.1.94991 WP_000683105.1.95011 WP_000683105.1.95022 WP_000683105.1.95035 WP_000683105.1.95129 WP_000683105.1.95275 WP_000683105.1.95332 WP_000683105.1.95368 WP_000683105.1.95381 WP_000683105.1.95431 WP_000683105.1.95634 WP_000683105.1.95824 WP_000683105.1.95834 WP_000683105.1.95835 WP_000683105.1.95849 WP_000683105.1.95861 WP_000683105.1.95931 WP_000683105.1.95951 WP_000683105.1.96053 WP_000683105.1.96066 WP_000683105.1.96110 WP_000683105.1.9616 WP_000683105.1.96222 WP_000683105.1.96281 WP_000683105.1.96303 WP_000683105.1.96339 WP_000683105.1.96425 WP_000683105.1.96450 WP_000683105.1.96562 WP_000683105.1.96585 WP_000683105.1.96609 WP_000683105.1.96650 WP_000683105.1.96725 WP_000683105.1.96779 WP_000683105.1.96796 WP_000683105.1.96864 WP_000683105.1.9690 WP_000683105.1.96936 WP_000683105.1.97049 WP_000683105.1.97059 WP_000683105.1.97066 WP_000683105.1.97123 WP_000683105.1.97193 WP_000683105.1.97200 WP_000683105.1.97269 WP_000683105.1.9729 WP_000683105.1.9740 WP_000683105.1.97402 WP_000683105.1.97421 WP_000683105.1.97439 WP_000683105.1.97464 WP_000683105.1.97513 WP_000683105.1.97632 WP_000683105.1.9770 WP_000683105.1.97789 WP_000683105.1.978 WP_000683105.1.97871 WP_000683105.1.98012 WP_000683105.1.98026 WP_000683105.1.9803 WP_000683105.1.98046 WP_000683105.1.98082 WP_000683105.1.98083 WP_000683105.1.981 WP_000683105.1.98115 WP_000683105.1.98155 WP_000683105.1.9817 WP_000683105.1.98176 WP_000683105.1.98187 WP_000683105.1.98202 WP_000683105.1.98205 WP_000683105.1.98239 WP_000683105.1.98251 WP_000683105.1.98279 WP_000683105.1.98292 WP_000683105.1.98312 WP_000683105.1.98384 WP_000683105.1.98400 WP_000683105.1.98543 WP_000683105.1.98569 WP_000683105.1.9858 WP_000683105.1.98603 WP_000683105.1.98654 WP_000683105.1.9883 WP_000683105.1.98920 WP_000683105.1.99029 WP_000683105.1.99101 WP_000683105.1.99168 WP_000683105.1.99182 WP_000683105.1.99234 WP_000683105.1.99302 WP_000683105.1.99334 WP_000683105.1.99349 WP_000683105.1.9935 WP_000683105.1.99400 WP_000683105.1.99487 WP_000683105.1.99501 WP_000683105.1.99534 WP_000683105.1.99562 WP_000683105.1.99571 WP_000683105.1.99619 WP_000683105.1.99641 WP_000683105.1.99666 WP_000683105.1.99692 WP_000683105.1.99698 WP_000683105.1.99804 WP_000683105.1.99929 WP_000683105.1.99986 YP_007111786.1.73778 YP_007112550.1.84097 155864.Z1893 386585.ECs1639 409438.ECSE_0603 409438.ECSE_2057 444450.ECH74115_1629 469008.ECBD_2864 544404.ECSP_1544 585395.ECO103_0547 595496.BWG_3730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]