SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226940569|ref|YP_002795643.1| from Laribacter hongkongensis HLHK9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226940569|ref|YP_002795643.1|
Domain Number 1 Region: 10-109
Classification Level Classification E-value
Superfamily Phage tail protein-like 0.00000000068
Family STM4215-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226940569|ref|YP_002795643.1|
Sequence length 150
Comment hypothetical protein LHK_01648 [Laribacter hongkongensis HLHK9]
Sequence
MLHQTEAGLIRQLQDSLPASVEVCGCPENREELRRPFDDGRVLVVYGGGKSAAPRDASGA
GQYRSEEWMLVIQHAKRSRLIGLVDAVTLILTGFRPPGAAGRMRHVADSSPEVLDATWSL
FQTWHIDAALVPLADPQDLHRFVPIFTKEP
Download sequence
Identical sequences C1D844
gi|226940569|ref|YP_002795643.1| 557598.LHK_01648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]