SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|238919584|ref|YP_002933099.1| from Edwardsiella ictaluri 93-146

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238919584|ref|YP_002933099.1|
Domain Number 1 Region: 9-162
Classification Level Classification E-value
Superfamily CAC2185-like 1.31e-38
Family CAC2185-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238919584|ref|YP_002933099.1|
Sequence length 196
Comment hypothetical protein NT01EI_1683 [Edwardsiella ictaluri 93-146]
Sequence
MLSRLIIKYRITDILDKIILRNKDFAIISNNCWGFHAYKIAKKPYNTPFIGLYIVPADFI
KMCANLSRYIGCTINKDSFIKSDMPFPVAQIQEITIYFMHYQSEEQAIRKWNDRMARLVR
YIAARGVDDVIFKMCERDGEKQHVNAFNALRFPRKISFEKTSCDKRLKDKDGDLLTGEQL
FNNRFVYYRKYISLYK
Download sequence
Identical sequences C5BDB2
634503.NT01EI_1683 WP_015871020.1.60554 WP_015871020.1.7078 WP_015871020.1.9917 gi|238919584|ref|YP_002933099.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]