SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|238921699|ref|YP_002935214.1| from Edwardsiella ictaluri 93-146

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238921699|ref|YP_002935214.1|
Domain Number 1 Region: 3-188
Classification Level Classification E-value
Superfamily HAD-like 1.99e-40
Family YihX-like 0.00000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238921699|ref|YP_002935214.1|
Sequence length 195
Comment HAD-superfamily hydrolase, subfamily IA, variant 3 [Edwardsiella ictaluri 93-146]
Sequence
MLYIFDLGNVIVDIDFHRVLGVWSRYSGAPLATLSKRFTMGDTFRQHERGAIDDETFARR
LCDEMGIALSFAQFELGWQAIFVALRPEVIDIMQRLRRQGERVVVLSNTNRLHTHFWPKH
YPEIAAACDKMYLSQELGMRKPDAEIYRYVLEQERVVAGESIFFDDNADNVAAAKALGIQ
AVQVCDRQVIPAYFA
Download sequence
Identical sequences C5BC73
gi|238921699|ref|YP_002935214.1| 634503.NT01EI_3860 WP_015873010.1.60554 WP_015873010.1.7078 WP_015873010.1.9917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]