SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257784667|ref|YP_003179884.1| from Atopobium parvulum DSM 20469

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257784667|ref|YP_003179884.1|
Domain Number 1 Region: 4-196
Classification Level Classification E-value
Superfamily HAD-like 6.51e-41
Family beta-Phosphoglucomutase-like 0.0057
Further Details:      
 
Domain Number 2 Region: 229-359
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 5.62e-20
Family Thiamin pyrophosphokinase, catalytic domain 0.01
Further Details:      
 
Domain Number 3 Region: 377-449
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.000000109
Family Thiamin pyrophosphokinase, substrate-binding domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257784667|ref|YP_003179884.1|
Sequence length 454
Comment thiamine pyrophosphokinase [Atopobium parvulum DSM 20469]
Sequence
MQVTGAIFDCDGTLVDSMCVWHNVFSAVLPKYGKTVDPDIFNRVEAVSLIGGCQICVDEL
ALPVTAETLYEEFCAYATDQYQHHVSIVPGAKEFLQELYDAGIPLAVASSTPVREVRAAL
AAQGIEHLFKTVVSTEDVGGVDKVEPDVYLEALRRLGTDKATTWVFEDAPFGAQTAQKAG
FPVVALYNDHDGRDPVFMREHSNIFAHTYGELSLLRLCDYERPLTSAPSGEKPLEVLIVG
GSPEAVSKTTLSTCVQSADYLIAVDHGADACHVAGVVPQLALGDFDSASLETVTWLKEQQ
VPCMKFNADKYDTDLALALKSAEHEAIRRNSKLSLTVVSTSGGHLDHQLVVLGLLAAWAK
TGKAKVRVVENDFEMRFLAADQIDSWQLDASATGKKISLVALSEECEVSESGMRWNLNHE
KFTLLGDDGISNIVEADGAWVKCEKGCLLVQLWN
Download sequence
Identical sequences C8W753
WP_012808950.1.33702 gi|257784667|ref|YP_003179884.1| 521095.Apar_0864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]