SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257785060|ref|YP_003180277.1| from Atopobium parvulum DSM 20469

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257785060|ref|YP_003180277.1|
Domain Number 1 Region: 126-265
Classification Level Classification E-value
Superfamily Sortase 2.35e-43
Family Sortase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257785060|ref|YP_003180277.1|
Sequence length 324
Comment sortase family protein [Atopobium parvulum DSM 20469]
Sequence
MANPKHMMAVLKAGESNDSPASLNASDKGIEKKKRARVWLIMSIIVLVAGVALISYPFVS
NWLNQLTQNNVSATQENTVVTMSKTDLSSEKERAIEFNKHLRDGASRVIDPFDSKESMPG
VTEYKEVLNIANDGVMGELIIPKISVNLPIYHFTTDDVLQHGVGHVVNTSVPIGGESTHT
VLAGHTGLPTARIFDRLNELQAGDWFIIHVLGEDHAYRVTSTEVVLPNQVDSLFIEPGKD
QVTLVTCTPYGVNTHRLLVHAERTDVPAEWNDQNELTNRSIDSSVDMSRHPILFSILGIV
CAGVVVSIAAFIAKRTKVFSKIKK
Download sequence
Identical sequences C8W896
gi|257785060|ref|YP_003180277.1| 521095.Apar_1261 WP_012809342.1.33702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]