SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Babin1|20278|gw1.6.252.1 from Babjeviella inositovora NRRL Y-12698 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Babin1|20278|gw1.6.252.1
Domain Number 1 Region: 1-72
Classification Level Classification E-value
Superfamily HMG-box 5.24e-20
Family HMG-box 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Babin1|20278|gw1.6.252.1
Sequence length 72
Sequence
RPRNSFILFRQKNHQAVLDDGVITTNPEVSRELGRRWRNLPPDEKEHWNRLADEEKRLHA
EKYPGYRYVPRK
Download sequence
Identical sequences A0A1E3QSA1
jgi|Babin1|20278|gw1.6.252.1 XP_018985145.1.12885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]