SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|338214825|ref|YP_004658888.1| from Runella slithyformis DSM 19594

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338214825|ref|YP_004658888.1|
Domain Number 1 Region: 29-79
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000724
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|338214825|ref|YP_004658888.1|
Sequence length 84
Comment proteinase inhibitor I2 Kunitz metazoa [Runella slithyformis DSM 19594]
Sequence
MKMRSFYTALSWTATIVCLLSCEGSCPVPPNCSLEPESGVCFAAFKRYYYDKREKKCKEF
TWGGCGGVVPFETLEACRDCECRR
Download sequence
Identical sequences F8EQK6
gi|338214825|ref|YP_004658888.1| WP_013931024.1.37789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]