SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|222110672|ref|YP_002552936.1| from Acidovorax ebreus TPSY

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222110672|ref|YP_002552936.1|
Domain Number 1 Region: 31-217
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.69e-38
Family RNA methyltransferase FtsJ 0.0000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222110672|ref|YP_002552936.1|
Sequence length 220
Comment ribosomal RNA methyltransferase rrmj/ftsj [Acidovorax ebreus TPSY]
Sequence
MKAQTKSKKVNKAWLHDHVNDTYVKLAQKEGYRARAAYKLKEIDEQLGLIKPGHVVVDLG
SSPGAWSQYVRRRLSPDGAAVGQLNGVIIALDILPMEPIEGVTFLQGDFREEEVLARLQE
AVQGRPVDVVVSDMAPNLSGVESVDAVRIAHLIELAVDFAVHHLKPEGALVVKLFHGSGY
SQLVQLFKDTFRVVKPMKPKASRDKSSETFLVGMGLKRQG
Download sequence
Identical sequences B9MI04
gi|222110672|ref|YP_002552936.1| WP_015913064.1.47842 535289.Dtpsy_1474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]