SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|222111030|ref|YP_002553294.1| from Acidovorax ebreus TPSY

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222111030|ref|YP_002553294.1|
Domain Number 1 Region: 15-199
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 9.21e-43
Family Protein-L-isoaspartyl O-methyltransferase 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|222111030|ref|YP_002553294.1|
Sequence length 236
Comment protein-l-isoaspartate(d-aspartate) o-methyltransferase [Acidovorax ebreus TPSY]
Sequence
MNMPLNTSADICDPTEQARYNMVEQQIRPWNVLDEAVLELLFTVRREEFVPPAYQGAAFI
DTQIPLNPSVEEAERLGQVMLAPRVDARMLQDLQVQSTDRVLEIGAGSGYMAALLAARAE
RVVSLEIVPELAEFARENLRSAGVDNAEVRQSDGALDPIPDGPFDVIVLSGSVAEIPQRL
LGLLRDGGRLGAFVGHMPMMRATFVRRQGDRYETTQPWDVVVPRLRHFPEPTRFKF
Download sequence
Identical sequences A1W7H9 B9MJF6
232721.Ajs_2028 535289.Dtpsy_1837 gi|222111030|ref|YP_002553294.1| WP_011805271.1.39107 WP_011805271.1.47842 gi|121594384|ref|YP_986280.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]