SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220903368|ref|YP_002478680.1| from Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220903368|ref|YP_002478680.1|
Domain Number 1 Region: 12-141
Classification Level Classification E-value
Superfamily Multiheme cytochromes 7.52e-24
Family Di-heme elbow motif 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220903368|ref|YP_002478680.1|
Sequence length 155
Comment NapC/NirT cytochrome c family protein [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
Sequence
MGTPRNGPWLKWLLGGVAAGVVLMGVLAYAMTTTDQRPFCASCHIMQEAAVTQKMGTHAN
LACNDCHAPHNLLVKLPFKAQEGLRDVVGNIMGHDIPRPLSLRTRDVVNANCKACHTQTN
INVASMDAKPYCVDCHKGVAHMRMKPISTRTVAYE
Download sequence
Identical sequences A0A1K1MX25 B8J207
525146.Ddes_0082 gi|220903368|ref|YP_002478680.1| WP_012623734.1.13825 WP_012623734.1.52045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]