SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|242399573|ref|YP_002994998.1| from Thermococcus sibiricus MM 739

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|242399573|ref|YP_002994998.1|
Domain Number 1 Region: 3-145
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.57e-36
Family AlaX-like 0.00000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|242399573|ref|YP_002994998.1|
Sequence length 148
Comment alanyl-tRNA synthetase-like protein [Thermococcus sibiricus MM 739]
Sequence
MEVKTHTALHVLKGAVVKVLGEEAKWTAAVYVNGNHGRLTIKFNRKPTKEEIAMIEEFAN
RKIEENAPIKVHELPREEAESRFGEDMYDLFPIPEEIRTLKVVVIEDWNINACNKEHTKT
TGEIGQIKIRKVRFRKVKELLEISFDVV
Download sequence
Identical sequences A0A101EM70 A0A117L6Q7 C6A4V4
604354.TSIB_1598 gi|242399573|ref|YP_002994998.1| WP_015849865.1.69891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]