SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|242399787|ref|YP_002995212.1| from Thermococcus sibiricus MM 739

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|242399787|ref|YP_002995212.1|
Domain Number 1 Region: 59-266
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.11e-57
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00012
Further Details:      
 
Domain Number 2 Region: 601-750
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.75e-47
Family AlaX-like 0.00079
Further Details:      
 
Domain Number 3 Region: 312-503
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 4.71e-46
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00016
Further Details:      
 
Domain Number 4 Region: 514-593
Classification Level Classification E-value
Superfamily Translation proteins 2.82e-18
Family AlaX-M N-terminal domain-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|242399787|ref|YP_002995212.1|
Sequence length 911
Comment Alanyl-tRNA synthetase [Thermococcus sibiricus MM 739]
Sequence
MVIIMDMSTRMFKEEGWLRKTCKVCGKPFWTIDPDRETCGDPPCDEYEFIGKPGIPRKYT
LEEMREAFLSYFERKNHGRVKRYPVLPRWRDDVLLVGASIMDFQPWVISGEADPPANPLT
ISQPSIRFTDIDNVGITGRHFTIFEMMAHHAFNYPGKPIYWMDETVEYAYEFFTKDLGMK
GEDITFKENPWAGGGNAGPAFEVLYRGLEVATLVFMQYKLAPPDADPSQIVEIKGDKYVP
MDTRVVDTGYGLERLVWMSQGTPTAYDAVLGYVVKPLKRMAGIDKIDDRILMENSRLAGM
FDIEDMGDLRVLRETVAKNVDMAPDELTRLVRPYELIYAIADHTKALTFMLADGVVPSNA
KAGYLARLLIRKSIRHLRELGLQIPLSEIVAMHIKELHKTFPEFKEMEDVVIDMVNVEER
KYADTLDRGNDLVRREIERLKKQGVGELPLERLMLFYESHGLTPEIVKEIAEKEGMTVRI
PDNFYSLVAKEAEKGIKEEEEKKIVDFELVQDLPDTRTLYYEEPLMKEFDAKVVGIIEDW
VVLDATAFYPEGGGQPCDLGELNGVEVLDVQKVGKIILHKVKEPEKFKERGIVHGKINWE
RRIQHMRHHTGTHVLMGALVRVLGKHVWQAGSQLSTDWARLDIAHYKRVSEEELKEIELL
ANRIVMEDREVKWEWLPRTEAEQRYGFRLYQGGVVPGRVIRVLNIKDWDVQACGGTHLPR
TGLIGPIKILRTERIQDGVERIIFACGEAAIKEWQKEREIISKTSEVFRVPLEKLPETAG
RFFEEWKQARKEVEKLNKELAKLLVYELENRVEKIGEIEFIGAVVEGEIDHLREAALKLK
KSNRIVALISEESNAVVVTVGEDLNYKAGDLIRIITRVAGGGGGGKKDLAQGKIKNILKA
KEALEELKKAL
Download sequence
Identical sequences C6A5G8
gi|242399787|ref|YP_002995212.1| 604354.TSIB_1812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]