SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220927613|ref|YP_002504522.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220927613|ref|YP_002504522.1|
Domain Number 1 Region: 731-1014
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.14e-85
Family beta-Galactosidase, domain 5 0.00018
Further Details:      
 
Domain Number 2 Region: 308-603
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.75e-84
Family beta-glycanases 0.000000554
Further Details:      
 
Domain Number 3 Region: 3-212
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-58
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.0000126
Further Details:      
 
Domain Number 4 Region: 214-307
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 1.93e-18
Family beta-Galactosidase/glucuronidase domain 0.0014
Further Details:      
 
Domain Number 5 Region: 613-709
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.00000000000165
Family beta-Galactosidase/glucuronidase domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220927613|ref|YP_002504522.1|
Sequence length 1030
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MIIENYFENPKILHVGTMEKRAYYVPYPPEDVNKSSDRNKSERLHLLNGEWDFLYLKSVY
NITDEFYLPGYDRAGFDKIPVPSVWQNHGYDRHQYTNIKYPFPYDPPHVPVDNPCGVYVR
EFYADTSWNGMRKYINFEGVDSCFYLWINGKFTGYSQVSHSTSEFDITDYVHEGVNTIAV
LVLKWCDGSYFEDQDKFRTSGIFRDVYILIRPENHIRDFFVRTSLKEDYKKAEIKVDMDI
FGSIPGIDYKLTDNSTGNIEAQGNANGKSISIEMDNPKLWSAEIPYLYTLIIRSDYEAIS
VQVGIREIKAEDGIVYLNGQKIKFKGVNRHDSDPVKGPAVDVKDMIKDLMLMKQHNINAI
RTSHYPNSPLFTELCDKYGCYVIAEADIEAHGTTAVYGGGQDGKSFPMLAHDSEFEDAVI
DRVESCVIRDKNHPCVVIWSLGNESGYGKNFESALDWLKGYDNSRLTHYESSLYPPEGYD
ADYSSLDLYSRMYASCEDIIEYFQGDNVSKPLILCEYSHAMGNGPGDLEEYHEQIERYDG
LCGGFVWEWCDHAVYMGRTVDGRKKYLYGGDFGEFPHDGNFCVDGLVYPDRRVHTGLLEY
KNVLRPLRLVNENSKDGKFTFKNMLDFINTKDFLFISYEVTKNGEVILDGVIDEPGLLDI
QPHEKKDICLTLHGVEEGDCYIKFDYIQKYDTPFVGSGHLLGFDQVKLAVDKVGLKEDKI
TCILGEPDSKEGEISVVESDRNAIIIGNNFRYTFNKMTGVFDKLIYKNNVILDKPMNYNI
WRAPTDNDRNVRHKWEEAGYDRTLSRSYNTQVFEENGNVRIITELSLLAVHIQRIMSIST
EWNIAENGLISVNIQAERNMEMPFLPRFGLRLFLPEYIRNVEYFGYGPHESYADKRRSSY
VGRFKSNVGRMHEDYLKPQENGSHWGCHYVKLASNCGLGLLVTGDETFSFNASYYTQEEL
TRKSHNFELEKCGSTVLCVDYAQSGIGSNSCGPELMEKYRFNAQRFHYTMFLRPFMEQPS
TAIVKAAHNT
Download sequence
Identical sequences B8I4I8
WP_012634608.1.84728 394503.Ccel_0154 gi|220927613|ref|YP_002504522.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]