SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220927689|ref|YP_002504598.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220927689|ref|YP_002504598.1|
Domain Number 1 Region: 42-471
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 4.16e-144
Family Cellulases catalytic domain 0.000000000874
Further Details:      
 
Domain Number 2 Region: 493-649
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 8.89e-35
Family Cellulose-binding domain family III 0.00018
Further Details:      
 
Domain Number 3 Region: 655-713
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000157
Family Type I dockerin domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220927689|ref|YP_002504598.1|
Sequence length 715
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MRKKFLKTTSFMLIMSLLVSLFVYAPTTVRAETSPRVGGSFYNYGEAMQKSILFYKANRL
GDLPDNYVLPYRGDAAMTDGKDVGLDLTGGWADAGDGIKFTHPMSYAAGQLGWAVYEYRD
AFEKSGQLDDILDEIKWATDFFIKAHPSPDVLYYMCGYEESDHSVWIPHELLDYKTDRKS
FKVDSTTPGSDVAGQTAAALAIASIIFEPTDPEYAETCLTHAKQLFKFGDTYRGKNPLKT
LYPSGGYLDDLAWGAIWLYIKTQDATYLEKAKSILPVTVLGGQHTHCWDDVSYGAALKIA
QAGRDESYAAMVEKNLDYWMPGTGIKYTPGGLAWLSQWGSLRYATTAAFLAFVWSDDKTI
GTASKKQTYHDFAERQINYALGDNPRGGSYEVGFGVDAPEHPHHRTAHGSWTSMLNVPTF
HRHILYGALVGGPSSDDSWKDDIKDYTLNEVATDYNAGFVGCLAKMYSMYGGNPLENWPK
AEDFRSPQDNLTEYFTRGWIIYEGYGKLKVMFQINNRSAWPATMKDKMSTRYYMDLSEIF
EAGGTVDDVQLTLEDSQGAKLIGLKQYKDNIYYFTVDFTGTQIMPAEWEMCEKDATVQIE
YKNGVGSNENDWSYQNISGPPDFDAVSFAGMSKYIPVYDNGKLLWGEEPAGKEPEVMYGD
INNDGNIDAIDFALLKKILMGDTSGNVNLTAADFNKDGDINAIDYAALKSYLQRG
Download sequence
Identical sequences Q0PRN4
gi|220927689|ref|YP_002504598.1| 394503.Ccel_0231 WP_012634683.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]