SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220927744|ref|YP_002504653.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220927744|ref|YP_002504653.1|
Domain Number 1 Region: 105-292
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.88e-46
Family NodB-like polysaccharide deacetylase 0.000000427
Further Details:      
 
Domain Number 2 Region: 33-94
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000128
Family Type I dockerin domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220927744|ref|YP_002504653.1|
Sequence length 308
Comment polysaccharide deacetylase [Clostridium cellulolyticum H10]
Sequence
MFNLRKALKGLLAVSLIAASVLVMSPVSKAADTVKYGDVNNDGVVDSIDYATVKSYLLGK
GTIANLTAADTNFDKAVDAIDFANLKKFLLGTITLPVGTPPITGKVVALTFDDGPDVTLT
PKVLDKLDKYRVPATFMMIGQKINDSTAPVIKRIISSGSEIGNHSWAYDSMSGMSYSAIK
KSVDDTTAAIVKYSGTTPKFFRAPNLATGGSMFDAIDLTFAGGVTCNDWVQSTTAQQRAD
AIIAGTRDGAILLMHDVQPLPHPTPEALDIIIPKLQSQGYTFVTLSDLFKIKGVTLSPTD
SKIYTYVP
Download sequence
Identical sequences B8I593
394503.Ccel_0286 gi|220927744|ref|YP_002504653.1| WP_012634738.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]